Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.44
PubTator Score 0.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18825932 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPMSSLPAAILSHMTAINNVPPPPLHSIPNLKKSKHINYGQLNALCHIRGQHSRSMSNILSAHDTFMKQY      1 - 70
PKVFLHQKPRLPKLFKQEEQRELNEGKEESQHQQPDDSNNIAVHVQRAHGGHILYRPKRATEKFEEFLAI     71 - 140
LKKLPIHRTPYEHKTVWKFLKTIPDLTFQLNDKHLKTLSKTVFSETWLKGSTVVANDGFYVILKGLARPQ    141 - 210
TNVYKNLIEGSDSPDSFISQSFHSFIWSEEFKNSTLAEMYLPSYDSMLSKWSTFGTLEVMPQNESETQMF    211 - 280
SVVTEDDCEILKIPAKGYAKIKEEKIKLENMQKLKLIRMCPYYEEWPTLSIYELIALLKWKKFPPGHVIV    281 - 350
ESGNIISFVGYINSGCCNIYRSIIGFVKLRSNKVKRSQKLVYMGKLKEKESFGEISVLLQVPFTCTIITK    351 - 420
KEVEMAIIEDKDLFVA                                                          421 - 436
//

Text Mined References (6)

PMID Year Title
23568457 2013 Genetic variants associated with disordered eating.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18825932 2008 [The influence of calcineurin gene polymorphism on morphofunctional characteristics of cardiovascular system of athletes].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.