Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 4.3e-24
group 3 medulloblastoma 4104 1.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Bipolar I disorder 23 4.524 2.3
Schizoaffective Disorder 55 4.184 2.1

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma -1.100 1.5e-03
psoriasis -2.700 4.3e-24

Gene RIF (4)

AA Sequence

MFCTRGLLFFAFLAGLDIEFTGLRSNLSGPQQISLFDLPSEWYLKTRQSVQQFTVCQIGLSVFSAIEGEA      1 - 70
NKYIAHSCNFYLFPTTFGILDSEFSFQASSVQFLNQYGFNYNKFLKNGIPYMNEEQEKKIRHDILTGNWR     71 - 140
VRSSPDKDQIKVVIDEVTRWLELAKEGDWMTLPGITGFQAFEVQLVLRQALPNIWTVLKDEGVVVKKVSK    141 - 210
QHRWYLQNTSCDRESCWKENILLSARGFSVFFQMLVKAQKPLVGHNMMMDLLHLHEKFFRPLPESYDQFK    211 - 280
QNIHSLFPVLIDTKSVTKDIWKEMNFPRVSNLSEVYEVLNSDLNPTKNSGPEIVHASRCEKYVETKCPHE    281 - 350
AAYDAFLCGSVLLKVAHLLLQKIYHIDPVPESSFPQYLDVLAPYVNQVNLIRAGVPKINFSGPDYPSIRP    351 - 420
PILILSVKRWPGVSEQQVYHKFQNLCKFDVRRLTRSQFLLLTNKFKDARNILKEYRDHPTLCISLYRYWR    421 - 490
HSPNVNCLLQVCGIVTAWALLAFILGRSGT                                            491 - 520
//

Text Mined References (10)

PMID Year Title