Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
nasopharyngeal carcinoma 1058 3.0e-07
psoriasis 6694 1.0e-06
lung carcinoma 2843 2.4e-03
ependymoma 4679 4.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 2.600 4.6e-02
lung carcinoma -1.100 2.4e-03
nasopharyngeal carcinoma -2.400 3.0e-07
psoriasis -1.200 1.0e-06

Gene RIF (2)

AA Sequence

MTTLPPLPMTRPKLTALARQKLPCSSRKIPRSQLIKEKDDIDHYLEVNFKGLSKEEVAAYRNSYKKNICV      1 - 70
DMLRDGYHKSFTELFALMERWDALREAARVRSLFWLQKPLEEQPDKLDYLYHYLTRAEDAERKESFEDVH     71 - 140
NNLYALACYFNNSEDKWVRNHFYERCFKIAQLIKIDCGKKEAEAHMHMGLLYEEDGQLLEAAEHYEAFHQ    141 - 210
LTQGRIWKDETGRSLNLLACESLLRTYRLLSDKMLENKEYKQAIKILIKASEIAKEGSDKKMEAEASYYL    211 - 280
GLAHLAAEEYETALTVLDTYCKISTDLDDDLSLGRGYEAIAKVLQSQGEMTEAIKYLKKFVKIARNNFQS    281 - 350
LDLVRASTMLGDIYNEKGYYNKASECFQQAFDTTVELMSMPLMDETKVHYGIAKAHQMMLTVNNYIESAD    351 - 420
LTSLNYLLSWKESRGNIEPDPVTEEFRGSTVEAVSQNSERLEELSRFPGDQKNET                   421 - 475
//

Text Mined References (9)

PMID Year Title