Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.90
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 5.35779624719144E-7
sonic hedgehog group medulloblastoma 1482 6.48741166270282E-6
spina bifida 1064 0.0370305573886606

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.144 0.000
sonic hedgehog group medulloblastoma 1.100 0.000
spina bifida -1.172 0.037

Synonym

Accession Q8NA42 Q6X2C7
Symbols HSD17

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG

Gene RIF (1)

PMID Text
15964543 Overexpression of ZNF383 in cells inhibits the transcriptional activities of AP-1 and SRE, suggesting that ZNF383 may act as a negative regulator in MAPK-mediated signaling pathways.

AA Sequence

MAEGSVMFSDVSIDFSQEEWDCLDPVQRDLYRDVMLENYGNLVSMGLYTPKPQVISLLEQGKEPWMVGRE      1 - 70
LTRGLCSDLESMCETKLLSLKKEVYEIELCQREIMGLTKHGLEYSSFGDVLEYRSHLAKQLGYPNGHFSQ     71 - 140
EIFTPEYMPTFIQQTFLTLHQIINNEDRPYECKKCGKAFSQNSQFIQHQRIHIGEKSYECKECGKFFSCG    141 - 210
SHVTRHLKIHTGEKPFECKECGKAFSCSSYLSQHQRIHTGKKPYECKECGKAFSYCSNLIDHQRIHTGEK    211 - 280
PYECKVCGKAFTKSSQLFQHARIHTGEKPYECKECGKAFTQSSKLVQHQRIHTGEKPYECKECGKAFSSG    281 - 350
SALTNHQRIHTGEKPYDCKECGKAFTQSSQLRQHQRIHAGEKPFECLECGKAFTQNSQLFQHQRIHTDEK    351 - 420
PYECNECGKAFNKCSNLTRHLRIHTGEKPYNCKECGKAFSSGSDLIRHQGIHTNK                   421 - 475
//

Text Mined References (3)

PMID Year Title
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
15964543 2005 ZNF383, a novel KRAB-containing zinc finger protein, suppresses MAPK signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.