Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.90
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.144 0.000
sonic hedgehog group medulloblastoma 1.100 0.000
spina bifida -1.172 0.037

Synonym

Accession Q8NA42 Q6X2C7
Symbols HSD17

Gene

Gene RIF (1)

PMID Text
15964543 Overexpression of ZNF383 in cells inhibits the transcriptional activities of AP-1 and SRE, suggesting that ZNF383 may act as a negative regulator in MAPK-mediated signaling pathways.

AA Sequence

MAEGSVMFSDVSIDFSQEEWDCLDPVQRDLYRDVMLENYGNLVSMGLYTPKPQVISLLEQGKEPWMVGRE      1 - 70
LTRGLCSDLESMCETKLLSLKKEVYEIELCQREIMGLTKHGLEYSSFGDVLEYRSHLAKQLGYPNGHFSQ     71 - 140
EIFTPEYMPTFIQQTFLTLHQIINNEDRPYECKKCGKAFSQNSQFIQHQRIHIGEKSYECKECGKFFSCG    141 - 210
SHVTRHLKIHTGEKPFECKECGKAFSCSSYLSQHQRIHTGKKPYECKECGKAFSYCSNLIDHQRIHTGEK    211 - 280
PYECKVCGKAFTKSSQLFQHARIHTGEKPYECKECGKAFTQSSKLVQHQRIHTGEKPYECKECGKAFSSG    281 - 350
SALTNHQRIHTGEKPYDCKECGKAFTQSSQLRQHQRIHAGEKPFECLECGKAFTQNSQLFQHQRIHTDEK    351 - 420
PYECNECGKAFNKCSNLTRHLRIHTGEKPYNCKECGKAFSSGSDLIRHQGIHTNK                   421 - 475
//

Text Mined References (3)

PMID Year Title
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
15964543 2005 ZNF383, a novel KRAB-containing zinc finger protein, suppresses MAPK signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.