Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.82
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 5.4e-07
sonic hedgehog group medulloblastoma 467 6.5e-06
spina bifida 1074 3.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.144 5.4e-07
sonic hedgehog group medulloblastoma 1.100 6.5e-06
spina bifida -1.172 3.7e-02

Gene RIF (1)

AA Sequence

MAEGSVMFSDVSIDFSQEEWDCLDPVQRDLYRDVMLENYGNLVSMGLYTPKPQVISLLEQGKEPWMVGRE      1 - 70
LTRGLCSDLESMCETKLLSLKKEVYEIELCQREIMGLTKHGLEYSSFGDVLEYRSHLAKQLGYPNGHFSQ     71 - 140
EIFTPEYMPTFIQQTFLTLHQIINNEDRPYECKKCGKAFSQNSQFIQHQRIHIGEKSYECKECGKFFSCG    141 - 210
SHVTRHLKIHTGEKPFECKECGKAFSCSSYLSQHQRIHTGKKPYECKECGKAFSYCSNLIDHQRIHTGEK    211 - 280
PYECKVCGKAFTKSSQLFQHARIHTGEKPYECKECGKAFTQSSKLVQHQRIHTGEKPYECKECGKAFSSG    281 - 350
SALTNHQRIHTGEKPYDCKECGKAFTQSSQLRQHQRIHAGEKPFECLECGKAFTQNSQLFQHQRIHTDEK    351 - 420
PYECNECGKAFNKCSNLTRHLRIHTGEKPYNCKECGKAFSSGSDLIRHQGIHTNK                   421 - 475
//

Text Mined References (3)

PMID Year Title