Property Summary

NCBI Gene PubMed Count 26
PubMed Score 26.33
PubTator Score 36.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (14)

AA Sequence

MAKGEGAESGSAAGLLPTSILQSTERPAQVKKEPKKKKQQLSVCNKLCYALGGAPYQVTGCALGFFLQIY      1 - 70
LLDVAQKDEEVVFCFSSFQVGPFSASIILFVGRAWDAITDPLVGLCISKSPWTCLGRLMPWIIFSTPLAV     71 - 140
IAYFLIWFVPDFPHGQTYWYLLFYCLFETMVTCFHVPYSALTMFISTEQTERDSATAYRMTVEVLGTVLG    141 - 210
TAIQGQIVGQADTPCFQDLNSSTVASQSANHTHGTTSHRETQKAYLLAAGVIVCIYIICAVILILGVREQ    211 - 280
REPYEAQQSEPIAYFRGLRLVMSHGPYIKLITGFLFTSLAFMLVEGNFVLFCTYTLGFRNEFQNLLLAIM    281 - 350
LSATLTIPIWQWFLTRFGKKTAVYVGISSAVPFLILVALMESNLIITYAVAVAAGISVAAAFLLPWSMLP    351 - 420
DVIDDFHLKQPHFHGTEPIFFSFYVFFTKFASGVSLGISTLSLDFAGYQTRGCSQPERVKFTLNMLVTMA    421 - 490
PIVLILLGLLLFKMYPIDEERRRQNKKALQALRDEASSSGCSETDSTELASIL                     491 - 543
//

Text Mined References (26)

PMID Year Title