Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.31
PubTator Score 2.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia -1.200 3.1e-03
Astrocytoma, Pilocytic 1.700 4.7e-04
Breast cancer -1.600 2.5e-07
osteosarcoma -1.520 1.4e-03
ovarian cancer -1.500 4.3e-07
sonic hedgehog group medulloblastoma 1.500 7.0e-03

Gene RIF (4)

AA Sequence

MKQPNRKRKLNMDSKERLDQDGRLEQAEEEKKPKDSTTPLSHVPSAAAQGAWSWEWYLKEQKAVAAPVEL      1 - 70
FSKDQSFPEHENGFQIGMRLEGIDPRHPSVFCVLSVAEVCGYRLRLHFDGYLSCYDFWTNAGSPDIHPVG     71 - 140
WCEKTKHELHIPKGYRKDKFVWMDYLKACKLQNAPKKLFRNRSPNGPMSKEFQVGMKLEAVDRKNPSLVC    141 - 210
VATIADIVEDRLLVHFDNWDDSYDYWCDVNSPYVQPVGWCQENGRTLIAPQGYPNPENFSWTEYLEATQT    211 - 280
NAVPAKVFKMRLPHGFLPNMKLEVVDKRNPRLIRVATIVDVDDQRVKVHFDGWDHKYDYWVEADSPDIHP    281 - 350
IGWCDVTGHPLEVPQRTNDLKILPGQAVCPTPGCRGIGHIRGPRYSGHHSAFGCPYSDMNLKKEATLHDR    351 - 420
LREQTQANLESDSSHSKSKSLCSLNFNGKHEKVNSQPRLVQQAKCLKIKGKEDIDLDNLFRVLVLHPRGL    421 - 490
EYSVEQAQQVLHQSVSMSTVSAHPFRDLPLGREQHCKLLPGVADIRASQVARWTVDEVAEFVQSLLGCEE    491 - 560
HAKCFKKEQIDGKAFLLLTQTDIVKVMKIKLGPALKIYNSILMFRHSQELPEEDIASGQEVRG           561 - 623
//

Text Mined References (13)

PMID Year Title