Property Summary

NCBI Gene PubMed Count 8
PubMed Score 32.90
PubTator Score 10.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
posterior fossa group B ependymoma 2.600 0.000
breast carcinoma 1.400 0.000
Breast cancer 1.200 0.003

Gene RIF (7)

PMID Text
25826084 FSIP1 may play an important role in the tumorigenesis and invasion of breast cancer and is a potential biomarker for breast cancer diagnosis or prognosis.
25013050 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that FSIP1 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with FSIP1
24968937 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that FSIP1 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with FSIP1
23905897 prevalence and uniformity of FSIP1 expression in breast tumors
20513247 association between the variants in FSIP1 and aspirin intolerant asthma occurrence among asthmatics in a Korean population
20513247 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDIIKGNLDGISKPASNSRIRPGSRSSNASLEVLSTEPGSFKVDTASNLNSGKEDHSESSNTENRRTSND      1 - 70
DKQESCSEKIKLAEEGSDEDLDLVQHQIISECSDEPKLKELDSQLQDAIQKMKKLDKILAKKQRREKEIK     71 - 140
KQGLEMRIKLWEEIKSAKYSEAWQSKEEMENTKKFLSLTAVSEETVGPSHEEEDTFSSVFHTQIPPEEYE    141 - 210
MQMQKLNKDFTCDVERNESLIKSGKKPFSNTEKIELRGKHNQDFIKRNIELAKESRNPVVMVDREKKRLV    211 - 280
ELLKDLDEKDSGLSSSEGDQSGWVVPVKGYELAVTQHQQLAEIDIKLQELSAASPTISSFSPRLENRNNQ    281 - 350
KPDRDGERNMEVTPGEKILRNTKEQRDLHNRLREIDEKLKMMKENVLESTSCLSEEQLKCLLDECILKQK    351 - 420
SIIKLSSERKKEDIEDVTPVFPQLSRSIISKLLNESETKVQKTEVEDADMLESEECEASKGYYLTKALTG    421 - 490
HNMSEALVTEAENMKCLQFSKDVIISDTKDYFMSKTLGIGRLKRPSFLDDPLYGISVSLSSEDQHLKLSS    491 - 560
PENTIADEQETKDAAEECKEP                                                     561 - 581
//

Text Mined References (9)

PMID Year Title
25826084 2015 Expression and clinicopathological significance of FSIP1 in breast cancer.
23905897 2013 Elevated expression of cancer/testis antigen FSIP1 in ER-positive breast tumors.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20513247 2010 Positive association between aspirin-intolerant asthma and genetic polymorphisms of FSIP1: a case-case study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12606363 2003 A-kinase anchoring protein 4 binding proteins in the fibrous sheath of the sperm flagellum.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.