Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.11
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Lung Neoplasms 232 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Lung adenoma 8 5.16 2.6

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.400 4.8e-04
atypical teratoid / rhabdoid tumor 1.100 2.3e-03
glioblastoma 1.200 6.3e-04
medulloblastoma, large-cell 1.700 2.4e-05
osteosarcoma 1.223 3.2e-05
ovarian cancer 1.200 7.6e-10
posterior fossa group B ependymoma 1.100 3.5e-04

Synonym

Accession Q8N9Z9 B4DL27 B4DY70 Q8IY38
Symbols IFLTD1
PAS1C1
LMNARS1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MLEGSWINRREDKLGVYSLVHFSPKMLGSVATTLPLSSSNSSGMPLGYYLSSPQISRVTISTTGQLTSKA      1 - 70
TVGSCSRVENSLDASPFSVPKKQDESPMIGDGEDYFLSLFGDSKKLTAHSNYTQKTLKYFSMILEEVGQF     71 - 140
TSSSLGDVEIAEVNVKGLFVKLINSSLDKEMAIGDHILQQNVNGQTISLYRFLPNIVMQANSTVTVWAAA    141 - 210
SEAKHQPPSDFLWKEQDKFRASPDCITILCKPNGQAIAWYTPIHWKQAWEKLDADVEFNRCSVVSPTFRK    211 - 280
RVFQWTASTATITKEKQDQPKKDISNYQVEQAQVLLKREKEIPPTVFPNRSPWCQNPYVSAHPYCPLIEP    281 - 350
HNTSTAGGRLDRQPRTRSTRPNRASGSKKKKTSESQKQ                                    351 - 388
//

Text Mined References (8)

PMID Year Title