Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.11
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.223 0.000
atypical teratoid / rhabdoid tumor 1.100 0.002
glioblastoma 1.200 0.001
medulloblastoma, large-cell 1.700 0.000
adult high grade glioma 1.400 0.000
posterior fossa group B ependymoma 1.100 0.000
ovarian cancer 1.200 0.000

AA Sequence

MLEGSWINRREDKLGVYSLVHFSPKMLGSVATTLPLSSSNSSGMPLGYYLSSPQISRVTISTTGQLTSKA      1 - 70
TVGSCSRVENSLDASPFSVPKKQDESPMIGDGEDYFLSLFGDSKKLTAHSNYTQKTLKYFSMILEEVGQF     71 - 140
TSSSLGDVEIAEVNVKGLFVKLINSSLDKEMAIGDHILQQNVNGQTISLYRFLPNIVMQANSTVTVWAAA    141 - 210
SEAKHQPPSDFLWKEQDKFRASPDCITILCKPNGQAIAWYTPIHWKQAWEKLDADVEFNRCSVVSPTFRK    211 - 280
RVFQWTASTATITKEKQDQPKKDISNYQVEQAQVLLKREKEIPPTVFPNRSPWCQNPYVSAHPYCPLIEP    281 - 350
HNTSTAGGRLDRQPRTRSTRPNRASGSKKKKTSESQKQ                                    351 - 388
//

Text Mined References (8)

PMID Year Title
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15688036 2005 Pas1c1 is a candidate for the mouse pulmonary adenoma susceptibility 1 locus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.