Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.11
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 7.63884070635991E-10
medulloblastoma, large-cell 6234 2.36012955963635E-5
osteosarcoma 7933 3.17764594962209E-5
posterior fossa group B ependymoma 1530 3.53788838486865E-4
adult high grade glioma 2148 4.7800902420696E-4
glioblastoma 5572 6.34085975435352E-4
atypical teratoid / rhabdoid tumor 4369 0.00228095896764179
Disease Target Count Z-score Confidence
Lung adenoma 8 5.164 2.6

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.223 0.000
atypical teratoid / rhabdoid tumor 1.100 0.002
glioblastoma 1.200 0.001
medulloblastoma, large-cell 1.700 0.000
adult high grade glioma 1.400 0.000
posterior fossa group B ependymoma 1.100 0.000
ovarian cancer 1.200 0.000

Synonym

Accession Q8N9Z9 B4DL27 B4DY70 Q8IY38
Symbols IFLTD1
PAS1C1

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG

AA Sequence

MLEGSWINRREDKLGVYSLVHFSPKMLGSVATTLPLSSSNSSGMPLGYYLSSPQISRVTISTTGQLTSKA      1 - 70
TVGSCSRVENSLDASPFSVPKKQDESPMIGDGEDYFLSLFGDSKKLTAHSNYTQKTLKYFSMILEEVGQF     71 - 140
TSSSLGDVEIAEVNVKGLFVKLINSSLDKEMAIGDHILQQNVNGQTISLYRFLPNIVMQANSTVTVWAAA    141 - 210
SEAKHQPPSDFLWKEQDKFRASPDCITILCKPNGQAIAWYTPIHWKQAWEKLDADVEFNRCSVVSPTFRK    211 - 280
RVFQWTASTATITKEKQDQPKKDISNYQVEQAQVLLKREKEIPPTVFPNRSPWCQNPYVSAHPYCPLIEP    281 - 350
HNTSTAGGRLDRQPRTRSTRPNRASGSKKKKTSESQKQ                                    351 - 388
//

Text Mined References (8)

PMID Year Title
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15688036 2005 Pas1c1 is a candidate for the mouse pulmonary adenoma susceptibility 1 locus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.