Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.38
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 2.11252185370231E-11
posterior fossa group A ependymoma 1511 6.64244220060283E-10
atypical teratoid / rhabdoid tumor 4369 1.77668323269751E-7
acute quadriplegic myopathy 1157 2.72634567170572E-6
cystic fibrosis 1670 1.58370287772948E-5
pediatric high grade glioma 2712 1.23493303354767E-4
glioblastoma 5572 1.33776150384352E-4
ovarian cancer 8492 1.59236200127182E-4
pilocytic astrocytoma 3086 3.21201046368576E-4
pituitary cancer 1972 7.7121769124542E-4
ulcerative colitis 2087 7.73638189750197E-4
primitive neuroectodermal tumor 3031 8.9506142023394E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00218318265816713
group 3 medulloblastoma 2254 0.00326947036127218
pancreatic cancer 2300 0.0156487293707505
gastric carcinoma 832 0.0166722079340126
medulloblastoma, large-cell 6234 0.0473906855185765

Expression

AA Sequence

MRRSMKRRRRRRPVAPATAARGGDFRAEDGAGLEAREEKVVYSRSQLSLADSTKALGDAFKLFMPRSTEF      1 - 70
MSSDAELWSFLCSLKHQFSPHILRSKDVYGYSSCRALVPDPPGPPTARGQARRPVPRAAARRRRRGARAA     71 - 140
AARRRKPRPPPPPPPPPEESCPAKPVAPGPCFGGRTLEEIWRAATPTLTTFPTIRVGSDVWGERSLAAAR    141 - 210
RRARQVLRVNLEPMVRLRRFPVPRA                                                 211 - 235
//

Text Mined References (10)

PMID Year Title
24951662 2014 Sequencing of 2 subclinical atherosclerosis candidate regions in 3669 individuals: Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) Consortium Targeted Sequencing Study.
24108091 2013 A single-molecule long-read survey of the human transcriptome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.