Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.55
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
acute quadriplegic myopathy 1.094 2.7e-06
adult high grade glioma 1.300 6.5e-03
Astrocytoma, Pilocytic 1.400 2.3e-04
atypical teratoid / rhabdoid tumor 1.400 1.8e-07
cystic fibrosis 1.447 1.6e-05
ependymoma 1.100 5.9e-04
gastric carcinoma 1.100 2.1e-02
glioblastoma 1.300 6.2e-04
group 3 medulloblastoma 2.000 3.3e-03
juvenile dermatomyositis 2.017 2.1e-11
medulloblastoma, large-cell -1.200 4.7e-02
ovarian cancer 1.500 1.1e-02
pancreatic cancer 1.300 1.6e-02
pancreatic ductal adenocarcinoma liver m... -1.975 2.2e-03
pituitary cancer -2.000 7.7e-04
primitive neuroectodermal tumor 1.400 9.0e-04
ulcerative colitis 1.100 7.7e-04

Synonym

Accession Q8N9Z2 Q7Z756
Symbols C7orf74

Gene

  Ortholog (1)

Species Source Disease
Mouse EggNOG Inparanoid

AA Sequence

MRRSMKRRRRRRPVAPATAARGGDFRAEDGAGLEAREEKVVYSRSQLSLADSTKALGDAFKLFMPRSTEF      1 - 70
MSSDAELWSFLCSLKHQFSPHILRSKDVYGYSSCRALVPDPPGPPTARGQARRPVPRAAARRRRRGARAA     71 - 140
AARRRKPRPPPPPPPPPEESCPAKPVAPGPCFGGRTLEEIWRAATPTLTTFPTIRVGSDVWGERSLAAAR    141 - 210
RRARQVLRVNLEPMVRLRRFPVPRA                                                 211 - 235
//

Text Mined References (10)

PMID Year Title