Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 9.5e-14
pituitary cancer 1972 1.6e-07
interstitial cystitis 2312 2.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0

Expression

  Differential Expression (3)

Disease log2 FC p
interstitial cystitis -1.100 2.0e-03
lung carcinoma 1.100 9.5e-14
pituitary cancer 1.400 1.6e-07

AA Sequence

MLCDEEAQKRKAKESGMALPQGRLTFMDVAIEFSQEEWKSLDPGQRALYRDVMLENYRNLVFLGICLPDL      1 - 70
SIISMLKQRREPLILQSQVKIVKNTDGRECVRSVNTGRSCVLGSNAENKPIKNQLGLTLEAHLSELQLFQ     71 - 140
AGRKIYRSNQVEKFTNHRSSVSPLQKISSSFTTHIFNKYRNDLIDFPLLPQEEKAYIRGKSYEYECSEDG    141 - 210
EVFRVRASLTNHQVIHTAEKPYKCTECGKVFSRNSHLVEHWRIHTGQKPYKCSECDKVFNRNSNLARHQR    211 - 280
IHTGEKPHKCNECGKAFRECSGLTTHLVIHTGEKPYKCNECGKNFRHKFSLTNHQRSHTAEKPYKCNECG    281 - 350
KVFSLLSYLARHQIIHSTEKPYKCNECGRAFHKRPGLMAHLLIHTGEKPYKCNECDKVFGRKLYLTNHQR    351 - 420
IHTGERPYKCNACGKVFNQNPHLSRHRKIHAGENSLRTLQME                                421 - 462
//

Text Mined References (6)

PMID Year Title