Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.3e-03

AA Sequence

MRPTADSFRLKKGNVFPNFDPCAQALQKSCHFALSFLIGKMGIIILSVCLICTRLLQEGIAQSKCLINVS      1 - 70
FSLYSCFIVFVTISQDSETLSLDCDHRLFFSLPFTDPASGGQSQHSWPCPERSKNLPQVSKQLRNRAG       71 - 138
//

Text Mined References (6)

PMID Year Title