Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Synonym

Accession Q8N9X3
Symbols

 Compartment GO Term (0)

AA Sequence

MSLRGRFYYCRHFRGRKQARRVGELPEVTELVSGPDWNPNTSQPMPGSPAPAPRRLPGCQRHPHPFKCCP      1 - 70
VPAPQSLPSTTRPHLPPTPQGQASRWLFLFLFQKLRGETDVCVPDACRWRRRSRETRGENQSVRAAVRSP     71 - 140
DQAFHALVSGSRGREGRLRPQCAGSAGGA                                             141 - 169
//

Text Mined References (2)

PMID Year Title