Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession Q8N9X3
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MSLRGRFYYCRHFRGRKQARRVGELPEVTELVSGPDWNPNTSQPMPGSPAPAPRRLPGCQRHPHPFKCCP      1 - 70
VPAPQSLPSTTRPHLPPTPQGQASRWLFLFLFQKLRGETDVCVPDACRWRRRSRETRGENQSVRAAVRSP     71 - 140
DQAFHALVSGSRGREGRLRPQCAGSAGGA                                             141 - 169
//

Text Mined References (2)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.