Knowledge Summary

Patent

No data available

AA Sequence

MYVSISFLLGLSHLVLCCLLTFIVNFYLPPESIDFEFMAHNWSKGRSPSSTLGLSWFKAGFRFSDGWSMF      1 - 70
YSFGLPGVALPGSPPRSHLLPGTQILIRSFQPCESAKHSARLSSLLTTTSYSVS                     71 - 124
//

Text Mined References (1)

PMID Year Title