Property Summary

NCBI Gene PubMed Count 23
Grant Count 14
R01 Count 8
Funding $1,013,873.91
PubMed Score 68.27
PubTator Score 69.17

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

PMID Text
25605553 Our study demonstrated an oncogenic role of BOLL in CRC despite tumor-specific promoter hypermethylation.
24086306 demonstrate that Boll is also transiently expressed during oogenesis in the fetal mouse ovary, but is simultaneously co-expressed within the same germ cells as Dazl
21474125 Assessing the expression of both CDY1 and BOULE by qualitative RT-PCR is a sensitive and feasible test for predicting the presence of sperm cells in testicular tissue biopsies.
19865085 human DAZL (deleted in azoospermia-like) functions in primordial germ-cell formation, whereas closely related genes DAZ and BOULE (also called BOLL) promote later stages of meiosis and development of haploid gametes
19417033 CDC25A is subject to translational control by BOLL, which is an evolutionarily conserved mechanism.
19342699 expression of spermatogenic phenotypes of partial AZFc deletions is independent of the variations in DAZL and BOULE in the Han population
19342699 Observational study of gene-disease association. (HuGE Navigator)
17114206 Among the three BOULE isoforms, B2 might have the major role for meiotic completion.
15705409 Observational study of genotype prevalence. (HuGE Navigator)
15705409 mutations in BOULE can be eliminated as a major cause of impaired spermatogenesis.
More...

AA Sequence

MQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAG      1 - 70
VSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTY     71 - 140
HNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQATTQYLPGQWQWSVPQPSASSAPFLY    141 - 210
LQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWS    211 - 280
IHY                                                                       281 - 283
//

Text Mined References (24)

PMID Year Title
25605553 2015 Oncogenic Role of BOLL in Colorectal Cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24086306 2013 A developmental stage-specific switch from DAZL to BOLL occurs during fetal oogenesis in humans, but not mice.
21474125 2011 CDY1 and BOULE transcripts assessed in the same biopsy as predictive markers for successful testicular sperm retrieval.
19865085 2009 Human DAZL, DAZ and BOULE genes modulate primordial germ-cell and haploid gamete formation.
19417033 2009 Posttranscriptional regulation of CDC25A by BOLL is a conserved fertility mechanism essential for human spermatogenesis.
19342699 Phenotypic expression of partial AZFc deletions is independent of the variations in DAZL and BOULE in a Han population.
18997786 2008 Susceptibility loci for intracranial aneurysm in European and Japanese populations.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...