Property Summary

NCBI Gene PubMed Count 3
PubMed Score 10.83
PubTator Score 2.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 8.0e-07
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.300 8.0e-07

AA Sequence

MWPQPHLPPHPMMSEKTRQNKLAEAKKKFTDYRQWNIAGVGTRATDTKKKKINNGTNPETTTSEGCHSPE      1 - 70
DTQQNRAQLKEEKKASHQHQEALRREIEAQDHTIRILTCQKTELETALYYSQDAARKFEDGNLGTPSSFN     71 - 140
LALSQAFRGSPLGCVSTSLIPGESKDLAGRLHHSWHFAGELQRALSAVSTWHKKADRYIEELTKERDALS    141 - 210
LELYRNTITNEELKKKNAELQEKLRLAESEKSEIQLNVKELKRKLERAKFLLPQVQTNTLQEEMWRQEEE    211 - 280
LREQEKKIRKQEEKMWRQEERLREQEGKMREQEEKMRRQEKRLREQEKELREQEKELREQKKLREQEEQM    281 - 350
QEQEEKMWEQEEKMREQEEKMWRQEERLWEQEKQMREQEQKMRDQEERMWEQDERLREKEERMREQEKMW    351 - 420
EQVEKMREEKKMQEQEKKTRDQEEKMQEEERIREREKKMREEEETMREQEEKMQKQEENMWEQEEKEWQQ    421 - 490
QRLPEQKEKLWEQEKMQEQEEKIWEQEEKIRDQEEMWGQEKKMWRQEKMREQEEEMREKEERIRDQKEKM    491 - 560
QERLPEHEERCSEPCLPPSKVLCNMSHTGSVEPAGGEAGEGSPQDNPTAQEIMQLFCGMKNAQQCPGLGS    561 - 630
TSCIPFFYRGDKRKMKIINI                                                      631 - 650
//

Text Mined References (5)

PMID Year Title