Property Summary

NCBI Gene PubMed Count 6
Grant Count 4
R01 Count 4
Funding $739,258.75
PubMed Score 0.50
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
osteosarcoma 7,933
ovarian cancer 8,484

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.854 0.000
ovarian cancer -1.100 0.000

AA Sequence

MVKLIHTLADHGDDVNCCAFSFSLLATCSLDKTIRLYSLRDFTELPHSPLKFHTYAVHCCCFSPSGHILA      1 - 70
SCSTDGTTVLWNTENGQMLAVMEQPSGSPVRVCQFSPDSTCLASGAADGTVVLWNAQSYKLYRCGSVKDG     71 - 140
SLAACAFSPNGSFFVTGSSCGDLTVWDDKMRCPHSEKAHDLGITCCDFSSQPVSDGEQGLQFFRLASCGQ    141 - 210
DCQVKIWIVSFTHILGFELKYKSTLSGHCAPVLACAFSHDGQMLVSGSVDKSVIVYDTNTENILHTLTQH    211 - 280
TRYVTTCAFAPNTLLLATGSMDKTVNIWQFDLETLCQARRTEHQLKQFTEDWSEEDVSTWLCAQDLKDLV    281 - 350
GIFKMNNIDGKELLNLTKESLADDLKIESLGLRSKVLRKIEELRTKVKSLSSGIPDEFICPITRELMKDP    351 - 420
VIASDGYSYEKEAMENWISKKKRTSPMTNLVLPSAVLTPNRTLKMAINRWLETHQK                  421 - 476
//

Text Mined References (7)

PMID Year Title
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.