Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.97
PubTator Score 0.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0

Gene RIF (1)

AA Sequence

MSTADLMENLREELTCFICLDYFSSPVTTECGHSFCLVCLLRSWEEHNTPLSCPECWRTLEGPHFQSNER      1 - 70
LGRLASIARQLRSQVLQSEDEQGSYGRMPTTAKALSDDEQGGSAFVAQSHGANRVHLSSEAEEHHREKLQ     71 - 140
EILNLLRVRRKEAQAVLTHEKERVKLCQEETKTCKQVVVSEYMKMHQFLKEEEQLQLQLLEQEEKENMRK    141 - 210
LRNNEIKLTQQIRSLSKMIAQIESSSQSSAFESLEEVRGALERSEPLLLQCPEATTTELSLCRITGMKEM    211 - 280
LRKFSTEITLDPATANAYLVLSEDLKSVKYGGSRQQLPDNPERFDQSATVLGTQIFTSGRHYWEVEVGNK    281 - 350
TEWEVGICKDSVSRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVCKVGVFLDYESGHIAF    351 - 420
YNGTDESLIYSFPQASFQEALRPIFSPCLPNEGTNTDPLTICSLNSHV                          421 - 468
//

Text Mined References (8)

PMID Year Title