Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.97
PubTator Score 0.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Carcinoma 2,147 1.0

Gene RIF (1)

PMID Text
19156909 This paper describes the mouse ortholog of the human TRIML1 gene.

AA Sequence

MSTADLMENLREELTCFICLDYFSSPVTTECGHSFCLVCLLRSWEEHNTPLSCPECWRTLEGPHFQSNER      1 - 70
LGRLASIARQLRSQVLQSEDEQGSYGRMPTTAKALSDDEQGGSAFVAQSHGANRVHLSSEAEEHHREKLQ     71 - 140
EILNLLRVRRKEAQAVLTHEKERVKLCQEETKTCKQVVVSEYMKMHQFLKEEEQLQLQLLEQEEKENMRK    141 - 210
LRNNEIKLTQQIRSLSKMIAQIESSSQSSAFESLEEVRGALERSEPLLLQCPEATTTELSLCRITGMKEM    211 - 280
LRKFSTEITLDPATANAYLVLSEDLKSVKYGGSRQQLPDNPERFDQSATVLGTQIFTSGRHYWEVEVGNK    281 - 350
TEWEVGICKDSVSRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVCKVGVFLDYESGHIAF    351 - 420
YNGTDESLIYSFPQASFQEALRPIFSPCLPNEGTNTDPLTICSLNSHV                          421 - 468
//

Text Mined References (8)

PMID Year Title
24528284 2014 Citalopram and escitalopram plasma drug and metabolite concentrations: genome-wide associations.
19156909 2009 Characterization and potential function of a novel pre-implantation embryo-specific RING finger protein: TRIML1.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.