Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.29
PubTator Score 3.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (2)

PMID Text
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of tandem C2 domains, nuclear (TC2N) in primary human brain microvascular endothelial cells
21029358 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MATEFIKSCCGGCFYGETEKHNFSVERDFKAAVPNSQNATISVPPLTSVSVKPQLGCTEDYLLSKLPSDG      1 - 70
KEVPFVVPKFKLSYIQPRTQETPSHLEELEGSARASFGDRKVELSSSSQHGPSYDVYNPFYMYQHISPDL     71 - 140
SRRFPPRSEVKRLYGSVCDLRTNKLPGSPGLSKSMFDLTNSSQRFIQRHDSLSSVPSSSSSRKNSQGSNR    141 - 210
SLDTITLSGDERDFGRLNVKLFYNSSVEQIWITVLQCRDLSWPSSYGDTPTVSIKGILTLPKPVHFKSSA    211 - 280
KEGSNAIEFMETFVFAIKLQNLQTVRLVFKIQTQTPRKKTIGECSMSLRTLSTQEMDYSLDITPPSKISV    281 - 350
CHAELELGTCFQAVNSRIQLQILEARYLPSSSTPLTLSFFVKVGMFSSGELIYKKKTRLLKASNGRVKWG    351 - 420
ETMIFPLIQSEKEIVFLIKLYSRSSVRRKHFVGQIWISEDSNNIEAVNQWKETVINPEKVVIRWHKLNPS    421 - 490
//

Text Mined References (14)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21810271 2011 Combined analysis of three genome-wide association studies on vWF and FVIII plasma levels.
21029358 2011 Impact on venous thrombosis risk of newly discovered gene variants associated with FVIII and VWF plasma levels.
18088087 2008 Phosphoproteome of resting human platelets.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
More...