Property Summary

NCBI Gene PubMed Count 7
PubMed Score 9.61
PubTator Score 4.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.5e-10
ovarian cancer 8520 2.1e-05
non primary Sjogren syndrome sicca 891 2.0e-02
group 3 medulloblastoma 4104 2.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Dental pulp necrosis 10 4.522 2.3

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.100 2.1e-02
non primary Sjogren syndrome sicca 1.100 2.0e-02
osteosarcoma -3.576 1.5e-10
ovarian cancer 1.100 2.1e-05

Synonym

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MPEPRGSSQLRVNAAFAARYNRYREREELQRLKDRYGDRDSSSDSSSESDSSDERVEFDPQQERDFYKTL      1 - 70
SLLKKKDPRIYQKDATFYNRTASSSDSEEDPEALEKQKKVRPMYLKDYERKVILEKAGKYVDEENSDGET     71 - 140
SNHRLQETSSQSYVEEQKQLKESFRAFVEDSEDEDGAGEGGSSLLQKRAKTRQEKAQEEADYIEWLKGQK    141 - 210
EIRNPDSLKELTHLKEYWNDPELDEGERFLRDYILNKRYEEEEEEEEDEEEMEEEEGVHGPPVQLAVDDS    211 - 280
SDEGELFLKKQEDFEQKYNFRFEEPDSASVKTYPRSIASSVRRKDERRKEKREETRERKKREKAKKQEEL    281 - 350
KQLKNLKRKEILAKLEKLRKVTGNEMLGLEEGDLEDDFDPAQHDQLMQKCFGDEYYGAVEEEKPQFEEEE    351 - 420
GLEDDWNWDTWDGPEQEGDWSQQELHCEDPNFNMDADYDPSQPRKKKREAPLTGKKKRKSPFAAAVGQEK    421 - 490
PVFEPGDKTFEEYLDEYYRLDYEDIIDDLPCRFKYRTVVPCDFGLSTEEILAADDKELNRWCSLKKTCMY    491 - 560
RSEQEELRDKRAYSQKAQNSWKKRQVFKSLCREEAETPAEATGKPQRDEAGPQRQLPALDGSLMGPESPP    561 - 630
AQEEEAPVSPHKKPAPQKRRRAKKARLLGPTVMLGGCEFSRQRLQAFGLNPKRLHFRQLGRQRRKQQGPK    631 - 700
NSS                                                                       701 - 703
//

Text Mined References (20)

PMID Year Title