Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q8N9T2 Q05CP2 Q14CJ5 Q7Z3P3
Symbols CXorf42

Gene

 Compartment GO Term (0)

AA Sequence

MSRFRGCSSSGVRFCSAEREASGSGRGNVLQFVQEPQAQQSRPFPAGAQLSLELLFSDWGMEWAQPRLPK      1 - 70
PALPLPVVVAFSRAADCAVDHHFRFCLLLRLLRQLLTLLRDEEREVNPWQRKIVV                    71 - 125
//

Text Mined References (6)

PMID Year Title