Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.05
PubTator Score 1.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma 1.900 0.038
interstitial cystitis -5.300 0.000
nasopharyngeal carcinoma -1.500 0.004
Pick disease 1.500 0.003
head and neck cancer and chronic obstruc... -1.200 0.039

Gene RIF (2)

PMID Text
25496667 Genome-wide shRNA screening identifies SNX31, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MKMHFCIPVSQQRSDALGGRYVLYSVHLDGFLFCRVRYSQLHGWNEQLRRVFGNCLPPFPPKYYLAMTTA      1 - 70
MADERRDQLEQYLQNVTMDPNVLRSDVFVEFLKLAQLNTFDIATKKAYLDIFLPNEQSIRIEIITSDTAE     71 - 140
RVLEVVSHKIGLCRELLGYFGLFLIRFGKEGKLSVVKKLADFELPYVSLGSSEVENCKVGLRKWYMAPSL    141 - 210
DSVLMDCRVAVDLLYMQAIQDIEKGWAKPTQAQRQKLEAFQKEDSQTKFLELAREVRHYGYLQLDPCTCD    211 - 280
YPESGSGAVLSVGNNEISCCITLPDSQTQDIVFQMSRVKCWQVTFLGTLLDTDGPQRTLNQNLELRFQYS    281 - 350
EDSCWQWFVIYTKQAFLLSSCLKKMISEKMVKLAAENTEMQIEVPEQSKSKKYHIQQSQQKDYSSFLSRK    351 - 420
SKIKIAKDDCVFGNIKEEDL                                                      421 - 440
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16782399 2006 The Phox (PX) domain proteins and membrane traffic.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12516573 2002 Lack of deleterious somatic mutations in the CD95 gene of plasmablasts from systemic lupus erythematosus patients and autoantibody-producing cell lines.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.