Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.06
PubTator Score 1.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma 1.900 3.8e-02
head and neck cancer and chronic obstruc... -1.200 3.9e-02
interstitial cystitis -3.300 2.0e-03
nasopharyngeal carcinoma -1.500 3.8e-03
Pick disease 1.500 2.8e-03

Gene RIF (2)

AA Sequence

MKMHFCIPVSQQRSDALGGRYVLYSVHLDGFLFCRVRYSQLHGWNEQLRRVFGNCLPPFPPKYYLAMTTA      1 - 70
MADERRDQLEQYLQNVTMDPNVLRSDVFVEFLKLAQLNTFDIATKKAYLDIFLPNEQSIRIEIITSDTAE     71 - 140
RVLEVVSHKIGLCRELLGYFGLFLIRFGKEGKLSVVKKLADFELPYVSLGSSEVENCKVGLRKWYMAPSL    141 - 210
DSVLMDCRVAVDLLYMQAIQDIEKGWAKPTQAQRQKLEAFQKEDSQTKFLELAREVRHYGYLQLDPCTCD    211 - 280
YPESGSGAVLSVGNNEISCCITLPDSQTQDIVFQMSRVKCWQVTFLGTLLDTDGPQRTLNQNLELRFQYS    281 - 350
EDSCWQWFVIYTKQAFLLSSCLKKMISEKMVKLAAENTEMQIEVPEQSKSKKYHIQQSQQKDYSSFLSRK    351 - 420
SKIKIAKDDCVFGNIKEEDL                                                      421 - 440
//

Text Mined References (8)

PMID Year Title