Property Summary

NCBI Gene PubMed Count 11
Grant Count 20
R01 Count 7
Funding $1,646,097
PubMed Score 276.32
PubTator Score 214.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma 2.400 0.000
astrocytic glioma -1.800 0.015
ependymoma -2.700 0.000
oligodendroglioma -1.500 0.040
psoriasis -1.100 0.005
glioblastoma -3.200 0.000
osteosarcoma -1.799 0.000
atypical teratoid / rhabdoid tumor -2.000 0.000
medulloblastoma -1.900 0.000
medulloblastoma, large-cell -3.000 0.000
primitive neuroectodermal tumor -1.500 0.006
tuberculosis and treatment for 3 months 1.700 0.000
non-small cell lung cancer -1.754 0.000
active ulcerative colitis -1.050 0.042
lung adenocarcinoma -1.200 0.000
pediatric high grade glioma -2.600 0.000
pilocytic astrocytoma -2.200 0.000
nasopharyngeal carcinoma 1.600 0.001
Pick disease -1.600 0.024
progressive supranuclear palsy 1.200 0.024
ovarian cancer -1.200 0.004
pituitary cancer 1.900 0.000

Gene RIF (7)

PMID Text
26314959 miR-625-3p exerts its oncogenic functions through regulation of SCAI/E-cadherin/MMP-9 pathways
26261546 miR-1228 promoted breast cancer proliferation, invasion and migration was mediated by MOAP1 and SCAI.
24785374 Downregulation of SCAI enhances glioma cell invasion and cancer stem cell like phenotype.Downregulation of SCAI activates the Wnt/beta-catenin signaling.
23593242 SCAI is a specific interaction partner for KMD3B.
23178076 SCAI is a novel transcriptional cofactor that regulates epithelial-to-mesenchymal transition and renal fibrosis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19350017 Genome-wide expression analysis surprisingly reveals that one of the strongest upregulated genes after suppression of SCAI is beta1-integrin

AA Sequence

MVRGARQPQQPRSRLAPRLTGTVEKPPRKRRSRTEFALKEIMSSGGAEDDIPQGERKTVTDFCYLLDKSK      1 - 70
QLFNGLRDLPQYGQKQWQSYFGRTFDVYTKLWKFQQQHRQVLDNRYGLKRWQIGEIASKIGQLYYHYYLR     71 - 140
TSETSYLNEAFSFYSAIRQRSYYSQVNKEDRPELVVKKLRYYARFIVVCLLLNKMDVVKDLVKELSDEIE    141 - 210
DYTHRFNTEDQVEWNLVLQEVAAFIEADPVMVLNDDNTIVITSNRLAETGAPLLEQGMIVGQLSLADALI    211 - 280
IGNCNNQVKFSELTVDMFRMLQALEREPMNLASQMNKPGMQESADKPTRRENPHKYLLYKPTFSQLYTFL    281 - 350
AASFKELPANSVLLIYLSATGVFPTGRSDSEGPYDFGGVLTNSNRDIINGDAIHKRNQSHKEMHCLHPGD    351 - 420
LYPFTRKPLFIIVDSSNSVAYKNFTNLFGQPLVCLLSPTAYPKALQDQSQRGSLFTLFLNNPLMAFLFVS    421 - 490
GLSSMRRGLWEKCQEYLRKINRDIAQLLTHSRSIDQAFLQFFGDEFLRLLLTRFIFCSATMRMHKIFRET    491 - 560
RNYPESYPQLPRDETVENPHLQKHILELASILDVRNVFFENTIDDY                            561 - 606
//

Text Mined References (12)

PMID Year Title
26314959 2015 MiR-625-3p promotes cell migration and invasion via inhibition of SCAI in colorectal carcinoma cells.
26261546 2015 MiR-1228 promotes breast cancer cell growth and metastasis through targeting SCAI protein.
24785374 2014 Downregulation of SCAI enhances glioma cell invasion and stem cell like phenotype by activating Wnt/?-catenin signaling.
23593242 2013 Protein complex interactor analysis and differential activity of KDM3 subfamily members towards H3K9 methylation.
23178076 2013 Characterization and role of SCAI during renal fibrosis and epithelial-to-mesenchymal transition.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19350017 2009 SCAI acts as a suppressor of cancer cell invasion through the transcriptional control of beta1-integrin.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
More...