Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 8.7e-07

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 8.7e-07

Synonym

Accession Q8N9R0
Symbols C16orf81
NCRNA00304

 Compartment GO Term (0)

AA Sequence

MQYLHCCLQIAPNQEGMVQAGGQGHGLARVVLRAVLSPPCWAPHSPCGSPAATEAGRLMRRLPSVGGRMT      1 - 70
APKTPRFLTRRPPASSPEDPPLPHPKTPRFLTQRPPASLPRRPRFLTLGPVSSHSSGDLRLWTAHQLPQQ     71 - 140
GGCPG                                                                     141 - 145
//

Text Mined References (2)

PMID Year Title