Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 0.000

Synonym

Accession Q8N9R0
Symbols C16orf81
NCRNA00304

Gene

 Compartment GO Term (0)

AA Sequence

MQYLHCCLQIAPNQEGMVQAGGQGHGLARVVLRAVLSPPCWAPHSPCGSPAATEAGRLMRRLPSVGGRMT      1 - 70
APKTPRFLTRRPPASSPEDPPLPHPKTPRFLTQRPPASLPRRPRFLTLGPVSSHSSGDLRLWTAHQLPQQ     71 - 140
GGCPG                                                                     141 - 145
//

Text Mined References (2)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.