Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.44
PubTator Score 4.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Melanoma 261
Disease Target Count P-value
osteosarcoma 7933 2.1e-08
atypical teratoid / rhabdoid tumor 4369 4.0e-07
ovarian cancer 8491 4.6e-03
group 3 medulloblastoma 2254 5.4e-03

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.312 2.1e-08
atypical teratoid / rhabdoid tumor -1.100 4.0e-07
group 3 medulloblastoma 1.200 5.4e-03
ovarian cancer 1.300 4.6e-03

Gene RIF (1)

PMID Text
22095125 Novel protein haponin regulates cellular response to oxidative stress.

AA Sequence

MSQATKRKHVVKEVLGEHIVPSDQQQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLI      1 - 70
VDPIEEGEKVKAEISFVLCKDHVRSLQKEGFWPEAFSEVAEKHNNRNRQTQPELPAEPQLSGEESSSEDD     71 - 140
SDLFVNTNRRQYHESEEESEEEEAA                                                 141 - 165
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22095125 Novel protein haponin regulates cellular response to oxidative stress.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20644585 [Haponin (eIF1AD) interacts with glyceraldehyde 3-phosphate dehydrogenase in the CHO-K1 cell line].
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18173130 [Identification and expression of haponin, a new protein from HL-60 cells].
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.