Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.44
PubTator Score 4.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.312 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
group 3 medulloblastoma 1.200 0.005
ovarian cancer 1.300 0.005

Synonym

Accession Q8N9N8 B2R4N5 Q9BSC1
Symbols haponin

Gene

PDB

2DGY  

Gene RIF (1)

PMID Text
22095125 Novel protein haponin regulates cellular response to oxidative stress.

AA Sequence

MSQATKRKHVVKEVLGEHIVPSDQQQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLI      1 - 70
VDPIEEGEKVKAEISFVLCKDHVRSLQKEGFWPEAFSEVAEKHNNRNRQTQPELPAEPQLSGEESSSEDD     71 - 140
SDLFVNTNRRQYHESEEESEEEEAA                                                 141 - 165
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22095125 Novel protein haponin regulates cellular response to oxidative stress.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20644585 [Haponin (eIF1AD) interacts with glyceraldehyde 3-phosphate dehydrogenase in the CHO-K1 cell line].
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18173130 [Identification and expression of haponin, a new protein from HL-60 cells].
More...