Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 1.60257586735782E-6
posterior fossa group A ependymoma 1511 6.03963036022649E-6
adult high grade glioma 2148 7.12933711395501E-5
glioblastoma 5572 5.46944977234607E-4
pilocytic astrocytoma 3086 0.00141701322389245
atypical teratoid / rhabdoid tumor 4369 0.00249059816053404
medulloblastoma, large-cell 6234 0.0062299820244942
ovarian cancer 8492 0.0104583944327224
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0139916502924129
group 3 medulloblastoma 2254 0.0309842282385889

Expression

  Differential Expression (10)

Synonym

Accession Q8N9N7 Q7Z2Z6 Q8N1T6
Symbols

Gene

  Ortholog (12)

AA Sequence

MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKIESLPPLLIGKFTLLKSLSLN      1 - 70
NNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQLGALPPQLCSLRHLDVMDLSK     71 - 140
NQIRSIPDSVGELQVIELNLNQNQISQISVKISCCPRLKILRLEENCLELSMLPQSILSDSQICLLAVEG    141 - 210
NLFEIKKLRELEGYDKYMERFTATKKKFA                                             211 - 239
//

Text Mined References (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...