Property Summary

NCBI Gene PubMed Count 36
Grant Count 8
R01 Count 7
Funding $439,175.65
PubMed Score 50.20
PubTator Score 26.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.100 0.000
osteosarcoma -1.017 0.001
tuberculosis -1.600 0.000
ovarian cancer 1.300 0.000

Gene RIF (22)

PMID Text
26080397 results reveal the complex molecular mechanism underlying SMAR1-mediated signal-dependent and -independent regulation of alternative splicing via Sam68 deacetylation
25299772 SMAR1-mediated regulation of repair and apoptosis via a complex crosstalk involving Ku70, HDAC6 and Bax.
25239884 Data indicate the role of SMAR1 protein in NF-kappaappa B dependent transcriptional regulation of pro-angiogenic chemokine interleukin-8 (IL-8).
25157104 SMAR1 has a role in repressing c-Fos-mediated HPV18 E6 transcription through alteration of chromatin histone deacetylation
25086032 indicate a crucial role for SMAR1 in restraining breast cancer cell migration and suggest the candidature of this scaffold matrix-associated region-binding protein as a tumor suppressor.
23876508 During hemin-induced erythroid differentiation, enhanced expression of SMAR1 negatively correlates with miR-320a expression.
22674979 TCF-4, beta-catenin, and SMAR1 tether at the -143-nucleotide site on the HIV LTR to inhibit HIV promoter activity.
22074660 Results indicate that SMAR1 is an important player in p300-p53 regulated DNA damage signalling pathway and can exert its effect on apoptosis in a transcription independent manner.
20709157 multiple roles of nuclear matrix associated protein SMAR1 in regulating various cellular target genes involved in cell growth, apoptosis and tumorigenesis.(REVIEW)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MMSEHDLADVVQIAVEDLSPDHPVVLENHVVTDEDEPALKRQRLEINCQDPSIKTICLRLDSIEAKLQAL      1 - 70
EATCKSLEEKLDLVTNKQHSPIQVPMVAGSPLGATQTCNKVRCVVPQTTVILNNDRQNAIVAKMEDPLSN     71 - 140
RAPDSLENVISNAVPGRRQNTIVVKVPGQEDSHHEDGESGSEASDSVSSCGQAGSQSIGSNVTLITLNSE    141 - 210
EDYPNGTWLGDENNPEMRVRCAIIPSDMLHISTNCRTAEKMALTLLDYLFHREVQAVSNLSGQGKHGKKQ    211 - 280
LDPLTIYGIRCHLFYKFGITESDWYRIKQSIDSKCRTAWRRKQRGQSLAVKSFSRRTPNSSSYCPSEPMM    281 - 350
STPPPASELPQPQPQPQALHYALANAQQVQIHQIGEDGQVQVGHLHIAQVPQGEQVQITQDSEGNLQIHH    351 - 420
VGQDGQLLEATRIPCLLAPSVFKASSGQVLQGAQLIAVASSDPAAAGVDGSPLQGSDIQVQYVQLAPVSD    421 - 490
HTAGAQTAEALQPTLQPEMQLEHGAIQIQ                                             491 - 519
//

Text Mined References (41)

PMID Year Title
26080397 2015 Nuclear matrix-associated protein SMAR1 regulates alternative splicing via HDAC6-mediated deacetylation of Sam68.
25416956 2014 A proteome-scale map of the human interactome network.
25299772 2014 SMAR1 coordinates HDAC6-induced deacetylation of Ku70 and dictates cell fate upon irradiation.
25239884 2014 Chromatin remodeling protein SMAR1 regulates NF-?B dependent Interleukin-8 transcription in breast cancer.
25157104 2014 Nuclear matrix protein SMAR1 represses c-Fos-mediated HPV18 E6 transcription through alteration of chromatin histone deacetylation.
25086032 2014 Inhibition of epithelial to mesenchymal transition by E-cadherin up-regulation via repression of slug transcription and inhibition of E-cadherin degradation: dual role of scaffold/matrix attachment region-binding protein 1 (SMAR1) in breast cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23876508 2013 miR-320a regulates erythroid differentiation through MAR binding protein SMAR1.
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...