Property Summary

NCBI Gene PubMed Count 37
PubMed Score 53.33
PubTator Score 26.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
tuberculosis 2010 4.9e-09
ovarian cancer 8520 3.8e-05
psoriasis 6694 1.8e-04
osteosarcoma 7950 1.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
Keratoconus 113 3.758 1.9
Disease Target Count
16q24.3 microdeletion syndrome 6

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.017 1.3e-03
ovarian cancer 1.300 3.8e-05
psoriasis 1.100 1.8e-04
tuberculosis -1.600 4.9e-09

Gene RIF (23)

AA Sequence

MMSEHDLADVVQIAVEDLSPDHPVVLENHVVTDEDEPALKRQRLEINCQDPSIKTICLRLDSIEAKLQAL      1 - 70
EATCKSLEEKLDLVTNKQHSPIQVPMVAGSPLGATQTCNKVRCVVPQTTVILNNDRQNAIVAKMEDPLSN     71 - 140
RAPDSLENVISNAVPGRRQNTIVVKVPGQEDSHHEDGESGSEASDSVSSCGQAGSQSIGSNVTLITLNSE    141 - 210
EDYPNGTWLGDENNPEMRVRCAIIPSDMLHISTNCRTAEKMALTLLDYLFHREVQAVSNLSGQGKHGKKQ    211 - 280
LDPLTIYGIRCHLFYKFGITESDWYRIKQSIDSKCRTAWRRKQRGQSLAVKSFSRRTPNSSSYCPSEPMM    281 - 350
STPPPASELPQPQPQPQALHYALANAQQVQIHQIGEDGQVQVGHLHIAQVPQGEQVQITQDSEGNLQIHH    351 - 420
VGQDGQLLEATRIPCLLAPSVFKASSGQVLQGAQLIAVASSDPAAAGVDGSPLQGSDIQVQYVQLAPVSD    421 - 490
HTAGAQTAEALQPTLQPEMQLEHGAIQIQ                                             491 - 519
//

Text Mined References (43)

PMID Year Title