Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.48
PubTator Score 33.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
ependymoma 4679 9.5e-11
ovarian cancer 8520 7.2e-06
osteosarcoma 7950 4.9e-04
psoriasis 6694 1.3e-03
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
Disease Target Count Z-score Confidence
Distal arthrogryposis 42 3.474 1.7
Disease Target Count
Barrett's esophagus 182

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.300 9.5e-11
osteosarcoma 1.517 4.9e-04
ovarian cancer 1.500 7.2e-06
psoriasis -1.100 1.3e-03

Gene RIF (5)

AA Sequence

MEVLRPQLIRIDGRNYRKNPVQEQTYQHEEDEEDFYQGSMECADEPCDAYEVEQTPQGFRSTLRAPSLLY      1 - 70
NLIHLNTSNDCGFQKITLDCQNIYTWKSRHIVGKRGDTRKKIEMETKTSISIPKPGQDGEIVITGQHRNG     71 - 140
VISARTRIDVLLDTFRRKQPFTHFLAFFLNEVEVQEGFLRFQEEVLAKCSMDHGVDSSIFQNPKKLHLTI    141 - 210
GMLVLLSEEEIQQTCEMLQQCKEEFINDISGGKPLEVEMAGIEYMNDDPGMVDVLYAKVHMKDGSNRLQE    211 - 280
LVDRVLERFQASGLIVKEWNSVKLHATVMNTLFRKDPNAEGRYNLYTAEGKYIFKERESFDGRNILKSFA    281 - 350
LLPRLEYNDAISAHCNLCLPGSSDSPASASQVAGITGVSDAYSQSLPGKS                        351 - 400
//

Text Mined References (17)

PMID Year Title