Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.59
PubTator Score 33.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.100 0.001
osteosarcoma 1.517 0.000
posterior fossa group B ependymoma 1.500 0.000
ovarian cancer 1.500 0.000

Synonym

Accession Q8N9N2 Q5SW06 Q5SW07 Q96EI8 Q9Y307
Symbols p50
CGI-18
SMABF2
ASC1p50

Gene

Gene RIF (5)

PMID Text
26503956 ASCC1 inhibits NF-kappaB activation and a truncated and inactive variant of ASCC1 is associated with a more severe disease, which could have clinical value for assessing the progression and prognosis of Rheumatoid Arthritis.
21791690 Three major genes, MSR1, ASCC1, and CTHRC1 were associated with Barrett esophagus/esophageal adenocarcinoma
19680556 Observational study of gene-disease association. (HuGE Navigator)
19074642 Gastrin activates paracrine networks leading to induction of PAI-2 via MAZ and ASC-1.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEVLRPQLIRIDGRNYRKNPVQEQTYQHEEDEEDFYQGSMECADEPCDAYEVEQTPQGFRSTLRAPSLLY      1 - 70
NLIHLNTSNDCGFQKITLDCQNIYTWKSRHIVGKRGDTRKKIEMETKTSISIPKPGQDGEIVITGQHRNG     71 - 140
VISARTRIDVLLDTFRRKQPFTHFLAFFLNEVEVQEGFLRFQEEVLAKCSMDHGVDSSIFQNPKKLHLTI    141 - 210
GMLVLLSEEEIQQTCEMLQQCKEEFINDISGGKPLEVEMAGIEYMNDDPGMVDVLYAKVHMKDGSNRLQE    211 - 280
LVDRVLERFQASGLIVKEWNSVKLHATVMNTLFRKDPNAEGRYNLYTAEGKYIFKERESFDGRNILKSFA    281 - 350
LLPRLEYNDAISAHCNLCLPGSSDSPASASQVAGITGVSDAYSQSLPGKS                        351 - 400
//

Text Mined References (17)

PMID Year Title
26924529 2016 Mutations in Subunits of the Activating Signal Cointegrator 1 Complex Are Associated with Prenatal Spinal Muscular Atrophy and Congenital Bone Fractures.
26503956 2015 A Truncated Variant of ASCC1, a Novel Inhibitor of NF-?B, Is Associated with Disease Severity in Patients with Rheumatoid Arthritis.
25416956 2014 A proteome-scale map of the human interactome network.
22055184 2011 DNA unwinding by ASCC3 helicase is coupled to ALKBH3-dependent DNA alkylation repair and cancer cell proliferation.
21791690 2011 Germline mutations in MSR1, ASCC1, and CTHRC1 in patients with Barrett esophagus and esophageal adenocarcinoma.
21269460 2011 Initial characterization of the human central proteome.
19680556 2009 Genetic variation in healthy oldest-old.
19074642 2009 Gastrin activates paracrine networks leading to induction of PAI-2 via MAZ and ASC-1.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
More...