Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.87
PubTator Score 1.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.200 3.3e-03
atypical teratoid / rhabdoid tumor -1.100 8.1e-04
ependymoma -1.500 2.1e-03
group 3 medulloblastoma -1.200 3.3e-02
medulloblastoma, large-cell -1.100 2.9e-02
oligodendroglioma -1.300 1.0e-03
pancreatic ductal adenocarcinoma liver m... -2.035 3.0e-04
primitive neuroectodermal tumor -1.100 8.7e-03
ulcerative colitis -1.100 2.2e-05

Gene RIF (2)

AA Sequence

MSATLILEPPGRCCWNEPVRIAVRGLAPEQRVTLRASLRDEKGALFRAHARYCADARGELDLERAPALGG      1 - 70
SFAGLEPMGLLWALEPEKPFWRFLKRDVQIPFVVELEVLDGHDPEPGRLLCQAQHERHFLPPGVRRQSVR     71 - 140
AGRVRATLFLPPGPGPFPGIIDIFGIGGGLLEYRASLLAGHGFATLALAYYNFEDLPNNMDNISLEYFEE    141 - 210
AVCYMLQHPQVKGPGIGLLGISLGADICLSMASFLKNVSATVSINGSGISGNTAINYKHSSIPPLGYDLR    211 - 280
RIKVAFSGLVDIVDIRNALVGGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAHGKEKP    281 - 350
QIICYPGTGHYIEPPYFPLCPASLHRLLNKHVIWGGEPRAHSKAQEDAWKQILAFFCKHLGGTQKTAVPK    351 - 420
L//

Text Mined References (13)

PMID Year Title