Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.83
PubTator Score 1.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.200 0.003
ependymoma -1.500 0.002
oligodendroglioma -1.300 0.001
atypical teratoid / rhabdoid tumor -1.100 0.001
medulloblastoma -1.300 0.001
medulloblastoma, large-cell -1.100 0.029
primitive neuroectodermal tumor -1.100 0.009
pancreatic ductal adenocarcinoma liver m... -2.035 0.000
ulcerative colitis -1.100 0.000

Synonym

Accession Q8N9L9 Q17RF4 Q5BKT6 Q86TX0 Q86TX1 Q96N88 Acyl-CoA thioesterase 4
Symbols PTE1B
PTE2B
PTE-Ib

Gene

PDB

3K2I  

Gene RIF (2)

PMID Text
25961151 Exome sequencing revealed an association with ACOT4 and increased risk of ischemic stroke.
16141203 ACOT4 and ACOT8 are responsible for the termination of beta-oxidation of dicarboxylic acids of medium-chain length with the concomitant release of the corresponding free acids

AA Sequence

MSATLILEPPGRCCWNEPVRIAVRGLAPEQRVTLRASLRDEKGALFRAHARYCADARGELDLERAPALGG      1 - 70
SFAGLEPMGLLWALEPEKPFWRFLKRDVQIPFVVELEVLDGHDPEPGRLLCQAQHERHFLPPGVRRQSVR     71 - 140
AGRVRATLFLPPGPGPFPGIIDIFGIGGGLLEYRASLLAGHGFATLALAYYNFEDLPNNMDNISLEYFEE    141 - 210
AVCYMLQHPQVKGPGIGLLGISLGADICLSMASFLKNVSATVSINGSGISGNTAINYKHSSIPPLGYDLR    211 - 280
RIKVAFSGLVDIVDIRNALVGGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAHGKEKP    281 - 350
QIICYPGTGHYIEPPYFPLCPASLHRLLNKHVIWGGEPRAHSKAQEDAWKQILAFFCKHLGGTQKTAVPK    351 - 420
L//

Text Mined References (13)

PMID Year Title
25961151 2015 Rare and Coding Region Genetic Variants Associated With Risk of Ischemic Stroke: The NHLBI Exome Sequence Project.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16940157 2006 Analysis of the mouse and human acyl-CoA thioesterase (ACOT) gene clusters shows that convergent, functional evolution results in a reduced number of human peroxisomal ACOTs.
16141203 2005 The identification of a succinyl-CoA thioesterase suggests a novel pathway for succinate production in peroxisomes.
16103133 2005 A revised nomenclature for mammalian acyl-CoA thioesterases/hydrolases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...