Property Summary

NCBI Gene PubMed Count 14
PubMed Score 16.06
PubTator Score 13.15

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma 1.200 6.2e-03
psoriasis 1.800 1.5e-19
subependymal giant cell astrocytoma -1.857 2.6e-03

Gene RIF (3)

AA Sequence

MRYKTSLVMRKRLRLYRNTLKESSSSSGHHGPQLTAASSPSVFPGLHEEPPQASPSRPLNGLLRLGLPGD      1 - 70
MYARPEPFPPGPAARSDALAAAAALHGYGGMNLTVNLAAPHGPGAFFRYMRQPIKQELICKWLAADGTAT     71 - 140
PSLCSKTFSTMHELVTHVTVEHVGGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPG    141 - 210
CGKVFARSENLKIHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSS    211 - 280
LRKHMKVHGRSPPPSSGYDSATPSALVSPSSDCGHKSQVASSAAVAARTADLSE                    281 - 334
//

Text Mined References (15)

PMID Year Title