Property Summary

NCBI Gene PubMed Count 14
Grant Count 16
R01 Count 10
Funding $1,698,367.76
PubMed Score 14.92
PubTator Score 13.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma 3.500 0.003
subependymal giant cell astrocytoma -1.857 0.003
psoriasis 1.800 0.000

Gene RIF (3)

PMID Text
22284968 ZIC4 CPG island methylation predicts progression in bladder cancer.
21204220 Dandy-Walker malformation associated with heterozygous ZIC1 and ZIC4 deletion.
15338008 Through physical mapping of 3q2 interstitial deletions in several individuals with Dandy-Walker malformation (DWM), we defined the first critical region associated with DWM, encompassing two adjacent Zinc finger in cerebellum genes, ZIC1 and ZIC4.

AA Sequence

MRYKTSLVMRKRLRLYRNTLKESSSSSGHHGPQLTAASSPSVFPGLHEEPPQASPSRPLNGLLRLGLPGD      1 - 70
MYARPEPFPPGPAARSDALAAAAALHGYGGMNLTVNLAAPHGPGAFFRYMRQPIKQELICKWLAADGTAT     71 - 140
PSLCSKTFSTMHELVTHVTVEHVGGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPG    141 - 210
CGKVFARSENLKIHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSS    211 - 280
LRKHMKVHGRSPPPSSGYDSATPSALVSPSSDCGHKSQVASSAAVAARTADLSE                    281 - 334
//

Text Mined References (15)

PMID Year Title
22284968 2012 Genome-wide analysis of CpG island methylation in bladder cancer identified TBX2, TBX3, GATA2, and ZIC4 as pTa-specific prognostic markers.
21204220 2011 Dandy-Walker malformation associated with heterozygous ZIC1 and ZIC4 deletion: Report of a new patient.
19425501 [Technology of analysis of epigenetic and structural changes of epithelial tumors genome with NotI-microarrays by the example of human chromosome].
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15733262 2005 The ZIC gene family in development and disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15477575 2004 Antibodies to Zic4 in paraneoplastic neurologic disorders and small-cell lung cancer.
15338008 2004 Heterozygous deletion of the linked genes ZIC1 and ZIC4 is involved in Dandy-Walker malformation.
15177559 2004 Comparative analysis of a 229-kb medaka genomic region, containing the zic1 and zic4 genes, with Fugu, human, and mouse.
More...