Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 3.0

Gene RIF (2)

AA Sequence

MQKQLLPLAAGQRCDYSQRESCCQSPHRAESAGDRSTDNGLHRGAERSFCCALDPLPRRPPAGRRGRDRS      1 - 70
SSACPGARARVWPPGACASFRDSHKRFIMRRTALFHFTPTSFHLRYTLRKL                        71 - 121
//

Text Mined References (13)

PMID Year Title