Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 2.43493886507254E-21
atypical teratoid / rhabdoid tumor 4369 4.79809251594467E-11
ependymoma 2514 9.02942142892986E-10
pilocytic astrocytoma 3086 1.42883266954215E-8
glioblastoma 5572 8.73721743946822E-8
pituitary cancer 1972 1.05556586850579E-6
primitive neuroectodermal tumor 3031 8.345506814585E-6
medulloblastoma 1524 3.17673690242309E-5
pediatric high grade glioma 2712 3.42932921435868E-5
osteosarcoma 7933 4.5002160110937E-5
psoriasis 6685 7.56198385930246E-5
medulloblastoma, large-cell 6234 8.42217091580417E-4
interstitial cystitis 2299 0.00123804945962265
cutaneous lupus erythematosus 1056 0.00234711223671933
subependymal giant cell astrocytoma 2287 0.00434341266704779
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00442070653555291
lung cancer 4473 0.0090523483776103
invasive ductal carcinoma 2950 0.0173750977926222
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 0.0 2.0

Synonym

Accession Q8N9K7
Symbols TRM9L
C8orf79

Gene

  Ortholog (8)

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
23381944 Study links hTRM9L and tRNA modifications to inhibition of tumour growth via LIN9 and HIF1-alpha-dependent mechanisms.

AA Sequence

MQKQLLPLAAGQRCDYSQRESCCQSPHRAESAGDRSTDNGLHRGAERSFCCALDPLPRRPPAGRRGRDRS      1 - 70
SSACPGARARVWPPGACASFRDSHKRFIMRRTALFHFTPTSFHLRYTLRKL                        71 - 121
//

Text Mined References (12)

PMID Year Title
24743840 2014 Genome-wide diet-gene interaction analyses for risk of colorectal cancer.
24677629 2014 A genome-wide association study of clinical symptoms of dissociation in a trauma-exposed sample.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23381944 2013 A human tRNA methyltransferase 9-like protein prevents tumour growth by regulating LIN9 and HIF1-?.
17903295 2007 Genetic correlates of longevity and selected age-related phenotypes: a genome-wide association study in the Framingham Study.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...