Property Summary

NCBI Gene PubMed Count 10
PubMed Score 13.40
PubTator Score 3.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count Z-score Confidence
Speech disorder 8 3.482 1.7

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 8.8e-03
Breast cancer -1.200 2.2e-05
ependymoma 1.100 3.7e-02
glioblastoma 1.200 2.8e-03
group 4 medulloblastoma 1.300 9.0e-03
interstitial lung disease 1.100 1.6e-02
lung adenocarcinoma 1.400 2.3e-04
medulloblastoma, large-cell 1.300 1.5e-04
osteosarcoma 1.213 9.6e-04
ovarian cancer -1.100 2.7e-07

Gene RIF (2)

AA Sequence

MSFVLSRMAACGGTCKNKVTVSKPVWDFLSKETPARLARLREEHRVSILIDGETSDIYVLQLSPQGPPPA      1 - 70
PPNGLYLARKALKGLLKEAEKELKKAQRQGELMGCLALGGGGEHPEMHRAGPPPLRAAPLLPPGARGLPP     71 - 140
PPPPLPPPLPPRLREEAEEQESTCPICLGEIQNAKTLEKCRHSFCEGCITRALQVKKACPMCGRFYGQLV    141 - 210
GNQPQNGRMLVSKDATLLLPSYEKYGTIVIQYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLT    211 - 280
LFRKAFDQRLTFTIGTSMTTGRPNVITWNDIHHKTSCTGGPQLFGYPDPTYLTRVQEELRAKGITDD       281 - 347
//

Text Mined References (12)

PMID Year Title