Property Summary

NCBI Gene PubMed Count 8
PubMed Score 11.52
PubTator Score 3.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
interstitial lung disease 1.100 0.016
ependymoma 1.100 0.037
osteosarcoma 1.213 0.001
atypical teratoid / rhabdoid tumor 1.200 0.009
glioblastoma 1.200 0.003
group 4 medulloblastoma 1.400 0.015
medulloblastoma, large-cell 1.300 0.000
lung adenocarcinoma 1.400 0.000
ovarian cancer -1.100 0.000
Breast cancer -1.200 0.000

Gene RIF (2)

PMID Text
17028573 We show here that both molecules (Deltex (DTX) and AIP4) interact and partially colocalize to endocytic vesicles, and that AIP4 targets DTX for lysosomal degradation.
12670957 It is reported that BBAP and the human family of DTX proteins (DTX1, DTX2, and DTX3) function as E3 ligases based on their capacity for self-ubiquitination.

AA Sequence

MSFVLSRMAACGGTCKNKVTVSKPVWDFLSKETPARLARLREEHRVSILIDGETSDIYVLQLSPQGPPPA      1 - 70
PPNGLYLARKALKGLLKEAEKELKKAQRQGELMGCLALGGGGEHPEMHRAGPPPLRAAPLLPPGARGLPP     71 - 140
PPPPLPPPLPPRLREEAEEQESTCPICLGEIQNAKTLEKCRHSFCEGCITRALQVKKACPMCGRFYGQLV    141 - 210
GNQPQNGRMLVSKDATLLLPSYEKYGTIVIQYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLT    211 - 280
LFRKAFDQRLTFTIGTSMTTGRPNVITWNDIHHKTSCTGGPQLFGYPDPTYLTRVQEELRAKGITDD       281 - 347
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17028573 2006 Itch/AIP4 mediates Deltex degradation through the formation of K29-linked polyubiquitin chains.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12670957 2003 The BAL-binding protein BBAP and related Deltex family members exhibit ubiquitin-protein isopeptide ligase activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11226752 2001 Murine homologs of deltex define a novel gene family involved in vertebrate Notch signaling and neurogenesis.
7671825 1995 Deltex acts as a positive regulator of Notch signaling through interactions with the Notch ankyrin repeats.