Property Summary

NCBI Gene PubMed Count 32
PubMed Score 86.71
PubTator Score 42.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Myasthenic Syndromes, Congenital 16 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 1.2e-11
osteosarcoma 7950 7.6e-06
psoriasis 6694 2.8e-04
group 3 medulloblastoma 4104 2.1e-03
subependymal giant cell astrocytoma 2287 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Congenital myasthenic syndrome 25 0.0 4.0
Disease Target Count Z-score Confidence
Botulism 24 6.263 3.1

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma -1.700 2.1e-03
osteosarcoma 1.629 7.6e-06
ovarian cancer 1.900 1.2e-11
psoriasis 1.400 2.8e-04
subependymal giant cell astrocytoma -1.717 1.6e-02

Gene RIF (10)

AA Sequence

MRNIFKRNQEPIVAPATTTATMPIGPVDNSTESGGAGESQEDMFAKLKEKLFNEINKIPLPPWALIAIAV      1 - 70
VAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENL     71 - 140
GKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTF    141 - 210
KVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRY    211 - 280
VPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQI    281 - 350
QKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK     351 - 419
//

Text Mined References (31)

PMID Year Title