Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.91
PubTator Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Werner syndrome 29 3.463 1.7

Expression

AA Sequence

MDPGDPAGDPAAGERHRMGRDPLLLLQALQTLWSTRERKQLREEAWRGFAALDDPLAGLLDMLESCRGQR      1 - 70
GEGPSLAAWISHQLQCWLQAQPCPSLAQHSLRLKQLQARAVKVLTESPPSLAAPLASIFQLQDADRSCLL     71 - 140
AHVHRLHHEGRFREAATLGATLKLQSELGVEKMSIPLLLQDKVALVERYVAGFPDLQRRLLVLMDSWCQP    141 - 210
GFDIKDVARRYPEVTSLSLEKLSPKALSRQVLRLQERYGVAPALCPNAAIQQRLAALRHLCHKRFVEKSL    211 - 280
SQENWTDHVQGLVGQSPWLQEQLSQLLVSHSDPVTAAQCAMELLLPEERLPAAVAVELRRFRLQGRATEA    281 - 350
DSRLEVKDMKDRYYQLPIPRENVHLLASWEDLTRHEGALLQCHQVVGVDVEWTPVFVAGGRPRPSLLQVA    351 - 420
VEGHVFLLDVLALSQPPTGQGAQAFSRLVAQLLSDPSITKLGYGMVGDLQKLGTSCPALAHVEKQILGGM    421 - 490
DLLLVHRQMRVASVPAPAVDRARELRGLSLLVQQVLGTALDKTQQLSNWDRRPLCEEQVIYAAADAYCLL    491 - 560
EVHQALCREPARFHLSEDLAGSRRPRHRERPGARKPPGLQKASAPAAPRQVPVAVAVSEGAAPQIPARAF    561 - 630
RVVCDNMLQGLARSLRCLGVDARMLGNGEDHRRAAEVARQEGRIILTSGQPFHKLRAQVGAGRCLSVDCS    631 - 700
LKAQQQAKAVLKHFNVRVTHADIFSRCQACNCDQYLKVSRDMMKQLMWLSSHQEGPRSSGDEATQSQAVQ    701 - 770
EPGPAPDAAPEGCTYDRPCRWLQMADLRAETPDMLADGTRLQLAGVPVGVLRTPGLRCFYCCTGCGKVFW    771 - 840
DGSHLGRVATHFRDMLESAPSPCEPSPAPSPASSPF                                      841 - 876
//

Text Mined References (7)

PMID Year Title
19060904 2009 An empirical framework for binary interactome mapping.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.