Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.91
PubTator Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 1.2e-04
medulloblastoma, large-cell 6241 1.6e-04
ependymoma 4679 5.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Werner syndrome 29 3.496 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma 1.500 5.6e-03
medulloblastoma, large-cell -1.200 1.6e-04
ovarian cancer -1.100 1.2e-04

AA Sequence

MDPGDPAGDPAAGERHRMGRDPLLLLQALQTLWSTRERKQLREEAWRGFAALDDPLAGLLDMLESCRGQR      1 - 70
GEGPSLAAWISHQLQCWLQAQPCPSLAQHSLRLKQLQARAVKVLTESPPSLAAPLASIFQLQDADRSCLL     71 - 140
AHVHRLHHEGRFREAATLGATLKLQSELGVEKMSIPLLLQDKVALVERYVAGFPDLQRRLLVLMDSWCQP    141 - 210
GFDIKDVARRYPEVTSLSLEKLSPKALSRQVLRLQERYGVAPALCPNAAIQQRLAALRHLCHKRFVEKSL    211 - 280
SQENWTDHVQGLVGQSPWLQEQLSQLLVSHSDPVTAAQCAMELLLPEERLPAAVAVELRRFRLQGRATEA    281 - 350
DSRLEVKDMKDRYYQLPIPRENVHLLASWEDLTRHEGALLQCHQVVGVDVEWTPVFVAGGRPRPSLLQVA    351 - 420
VEGHVFLLDVLALSQPPTGQGAQAFSRLVAQLLSDPSITKLGYGMVGDLQKLGTSCPALAHVEKQILGGM    421 - 490
DLLLVHRQMRVASVPAPAVDRARELRGLSLLVQQVLGTALDKTQQLSNWDRRPLCEEQVIYAAADAYCLL    491 - 560
EVHQALCREPARFHLSEDLAGSRRPRHRERPGARKPPGLQKASAPAAPRQVPVAVAVSEGAAPQIPARAF    561 - 630
RVVCDNMLQGLARSLRCLGVDARMLGNGEDHRRAAEVARQEGRIILTSGQPFHKLRAQVGAGRCLSVDCS    631 - 700
LKAQQQAKAVLKHFNVRVTHADIFSRCQACNCDQYLKVSRDMMKQLMWLSSHQEGPRSSGDEATQSQAVQ    701 - 770
EPGPAPDAAPEGCTYDRPCRWLQMADLRAETPDMLADGTRLQLAGVPVGVLRTPGLRCFYCCTGCGKVFW    771 - 840
DGSHLGRVATHFRDMLESAPSPCEPSPAPSPASSPF                                      841 - 876
//

Text Mined References (7)

PMID Year Title