Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.74
PubTator Score 4.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
18991142 3-D model provides the structural information; subcellular localization is in the cytoplasm; over-expression of GDE4 did not induce neurite formation or change cell morphology
14612981 A novel splice variant of the gene is mainly expressed in human ovary and small intestine.

AA Sequence

MSSTAAFYLLSTLGGYLVTSFLLLKYPTLLHQRKKQRFLSKHISHRGGAGENLENTMAAFQHAVKIGTDM      1 - 70
LELDCHITKDEQVVVSHDENLKRATGVNVNISDLKYCELPPYLGKLDVSFQRACQCEGKDNRIPLLKEVF     71 - 140
EAFPNTPINIDIKVNNNVLIKKVSELVKRYNREHLTVWGNANYEIVEKCYKENSDIPILFSLQRVLLILG    141 - 210
LFFTGLLPFVPIREQFFEIPMPSIILKLKEPHTMSRSQKFLIWLSDLLLMRKALFDHLTARGIQVYIWVL    211 - 280
NEEQEYKRAFDLGATGVMTDYPTKLRDFLHNFSA                                        281 - 314
//

Text Mined References (10)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
18991142 2008 Isolation, characterization and molecular 3D model of human GDE4, a novel membrane protein containing glycerophosphodiester phosphodiesterase domain.
17690467 2007 Mammalian glycerophosphodiester phosphodiesterases.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16147865 2005 A novel splice variant of human gene NPL, mainly expressed in human liver, kidney and peripheral blood leukocyte.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14612981 2003 A novel splice variant of human gene GDPD1 is mainly expressed in human ovary and small intestine.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.