Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.74
PubTator Score 4.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 9.97307710237746E-18
medulloblastoma, large-cell 6234 2.69045190011694E-6
interstitial cystitis 2299 4.16067072428598E-4
invasive ductal carcinoma 2950 8.26686520086578E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 9.41760869943223E-4
glioblastoma 5572 0.00439030660585443
subependymal giant cell astrocytoma 2287 0.00900923275586192
atypical teratoid / rhabdoid tumor 4369 0.0123932809787918
pediatric high grade glioma 2712 0.0191508489768008
ependymoma 2514 0.0271479260932677
ductal carcinoma in situ 1745 0.0434643216598851
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0438323072254824

Expression

Synonym

Accession Q8N9F7 A8W735 Q56VR1 Q8N4E3
Symbols GDE4

Gene

PANTHER Protein Class (2)

  Ortholog (13)

Gene RIF (2)

PMID Text
18991142 3-D model provides the structural information; subcellular localization is in the cytoplasm; over-expression of GDE4 did not induce neurite formation or change cell morphology
14612981 A novel splice variant of the gene is mainly expressed in human ovary and small intestine.

AA Sequence

MSSTAAFYLLSTLGGYLVTSFLLLKYPTLLHQRKKQRFLSKHISHRGGAGENLENTMAAFQHAVKIGTDM      1 - 70
LELDCHITKDEQVVVSHDENLKRATGVNVNISDLKYCELPPYLGKLDVSFQRACQCEGKDNRIPLLKEVF     71 - 140
EAFPNTPINIDIKVNNNVLIKKVSELVKRYNREHLTVWGNANYEIVEKCYKENSDIPILFSLQRVLLILG    141 - 210
LFFTGLLPFVPIREQFFEIPMPSIILKLKEPHTMSRSQKFLIWLSDLLLMRKALFDHLTARGIQVYIWVL    211 - 280
NEEQEYKRAFDLGATGVMTDYPTKLRDFLHNFSA                                        281 - 314
//

Text Mined References (10)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
18991142 2008 Isolation, characterization and molecular 3D model of human GDE4, a novel membrane protein containing glycerophosphodiester phosphodiesterase domain.
17690467 2007 Mammalian glycerophosphodiester phosphodiesterases.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16147865 2005 A novel splice variant of human gene NPL, mainly expressed in human liver, kidney and peripheral blood leukocyte.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14612981 2003 A novel splice variant of human gene GDPD1 is mainly expressed in human ovary and small intestine.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.