Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.87
PubTator Score 4.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (2)

AA Sequence

MSSTAAFYLLSTLGGYLVTSFLLLKYPTLLHQRKKQRFLSKHISHRGGAGENLENTMAAFQHAVKIGTDM      1 - 70
LELDCHITKDEQVVVSHDENLKRATGVNVNISDLKYCELPPYLGKLDVSFQRACQCEGKDNRIPLLKEVF     71 - 140
EAFPNTPINIDIKVNNNVLIKKVSELVKRYNREHLTVWGNANYEIVEKCYKENSDIPILFSLQRVLLILG    141 - 210
LFFTGLLPFVPIREQFFEIPMPSIILKLKEPHTMSRSQKFLIWLSDLLLMRKALFDHLTARGIQVYIWVL    211 - 280
NEEQEYKRAFDLGATGVMTDYPTKLRDFLHNFSA                                        281 - 314
//

Text Mined References (11)

PMID Year Title