Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.75
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.200 5.5e-03
atypical teratoid / rhabdoid tumor -2.400 6.6e-10
ependymoma -1.700 1.7e-09
glioblastoma -1.300 1.0e-03
group 3 medulloblastoma -1.300 1.5e-02
medulloblastoma, large-cell -1.800 5.9e-03
ovarian cancer -1.400 6.7e-06
primitive neuroectodermal tumor -1.500 6.1e-03
psoriasis -1.400 3.0e-14

AA Sequence

MGKRDNRVAYMNPIAMARWRGPTQSVGPTIQDYLNRPRPTWEEVKKQLENKKTGSKALAEFEEKMNENWK      1 - 70
KELEKSREKLLSGNESSSKKRERKKKRKKKSCRSSSSSSSSDSSSSSSDSEDEEKKQGKRRKKKKNRSYK     71 - 140
SSQSSTHESESESKESVKKKKKSKDETEKEKDVRSLSKKRKKSYPDDKPLSSESSSESDYEEDVQAKKKR    141 - 210
RCEEREQAKEKVKKKKKKQHKKHSKKKKKKSGSSHKSR                                    211 - 248
//

Text Mined References (7)

PMID Year Title