Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.75
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
ependymoma -1.900 0.000
glioblastoma -1.800 0.000
group 4 medulloblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -2.400 0.000
medulloblastoma, large-cell -2.000 0.000
primitive neuroectodermal tumor -1.500 0.006
pediatric high grade glioma -1.400 0.000
ovarian cancer -1.400 0.000
psoriasis -1.400 0.000

Synonym

Accession Q8N9E0
Symbols CT115

Gene

 Compartment GO Term (0)

AA Sequence

MGKRDNRVAYMNPIAMARWRGPTQSVGPTIQDYLNRPRPTWEEVKKQLENKKTGSKALAEFEEKMNENWK      1 - 70
KELEKSREKLLSGNESSSKKRERKKKRKKKSCRSSSSSSSSDSSSSSSDSEDEEKKQGKRRKKKKNRSYK     71 - 140
SSQSSTHESESESKESVKKKKKSKDETEKEKDVRSLSKKRKKSYPDDKPLSSESSSESDYEEDVQAKKKR    141 - 210
RCEEREQAKEKVKKKKKKQHKKHSKKKKKKSGSSHKSR                                    211 - 248
//

Text Mined References (7)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.