Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.75
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 3.00532584792601E-14
ependymoma 2514 3.01730886274747E-13
atypical teratoid / rhabdoid tumor 4369 6.60923253191032E-10
ovarian cancer 8492 6.66407125167438E-6
group 4 medulloblastoma 1875 1.32362466160093E-5
pediatric high grade glioma 2712 3.52575794993581E-4
medulloblastoma, large-cell 6234 4.01810124156443E-4
glioblastoma 5572 4.42296448523026E-4
primitive neuroectodermal tumor 3031 0.00612227814717449

Expression

  Differential Expression (9)

Disease log2 FC p
ependymoma -1.900 0.000
glioblastoma -1.800 0.000
group 4 medulloblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -2.400 0.000
medulloblastoma, large-cell -2.000 0.000
primitive neuroectodermal tumor -1.500 0.006
pediatric high grade glioma -1.400 0.000
ovarian cancer -1.400 0.000
psoriasis -1.400 0.000

AA Sequence

MGKRDNRVAYMNPIAMARWRGPTQSVGPTIQDYLNRPRPTWEEVKKQLENKKTGSKALAEFEEKMNENWK      1 - 70
KELEKSREKLLSGNESSSKKRERKKKRKKKSCRSSSSSSSSDSSSSSSDSEDEEKKQGKRRKKKKNRSYK     71 - 140
SSQSSTHESESESKESVKKKKKSKDETEKEKDVRSLSKKRKKSYPDDKPLSSESSSESDYEEDVQAKKKR    141 - 210
RCEEREQAKEKVKKKKKKQHKKHSKKKKKKSGSSHKSR                                    211 - 248
//

Text Mined References (7)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.