Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Carcinoma 2,147 1.0

Expression

AA Sequence

MTTIHSRQMLQEHVSMEFSSSTTHVQTFSQTTKIVGEEVVRRKSSSIVEFFSLVTRSSNIPAGDSVPEFV      1 - 70
EKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKLEPLTSDDSDNYKC     71 - 140
IASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAPPAPKKKQKKVANEKEMLEILSKVPKKDFEKVCMEY    141 - 210
GFTDFRGLLRKLKEMKKKVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYS    211 - 280
LGKYDVKQMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVFEIR    281 - 350
LSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTVDRIPIK    351 - 420
FVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTV    421 - 490
VAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQ    491 - 560
IVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVP    561 - 630
FRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLEP    631 - 700
PGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTE    701 - 770
YEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAEGDPPSGYILEMRA    771 - 840
EDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPGLTTT           841 - 903
//

Text Mined References (5)

PMID Year Title
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.