Property Summary

NCBI Gene PubMed Count 21
Grant Count 15
R01 Count 12
Funding $3,741,750
PubMed Score 20.81
PubTator Score 13.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
hepatocellular carcinoma -1.100 0.000
osteosarcoma -1.212 0.000
glioblastoma -1.500 0.002
juvenile dermatomyositis 1.417 0.000
acute quadriplegic myopathy 1.237 0.000
adult high grade glioma -1.100 0.008
group 3 medulloblastoma 1.400 0.000
psoriasis 1.700 0.000
spina bifida -2.531 0.048
ovarian cancer -1.100 0.000

Gene RIF (10)

PMID Text
26223951 In autophagosomes, the integrity of the WH2 domains allows JMY to promote actin nucleation, which is required for efficient autophagosome formation.
25280461 JMY was expressed in normal tissues and heterogeneously in different tumor types, with close correlation between cytoplasmic and nuclear expression.
24069348 JARID1A, JMY, and PTGER4 polymorphisms are related to ankylosing spondylitis in Chinese Han patients.
23758122 JMY is related to the severity of AS in Chinese Han patients.
22262458 actin assembly regulates nuclear import of JMY in response to DNA damage.
21965285 JMY is expressed at high levels in brain tissue, and in various cell lines JMY is predominantly cytoplasmic, with a minor fraction in the nucleus.
21625218 results establish the interplay between JMY and HIF-1alpha as a new mechanism that controls cell motility under hypoxic stress
19897726 Data demonstrate a pathway that links the cytoskeleton with the p53 response, and further suggest that the ability of JMY to regulate actin and cadherin is instrumental in coordinating cell motility with the p53 response.
19287377 JMY represents a new class of multifunctional actin assembly factor whose activity is regulated, at least in part, by sequestration in the nucleus.
18398821 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSFALEETLESDWVAVRPHVFDEREKHKFVFIVAWNEIEGKFAITCHNRTAQRQRSGSREQAGARGGAEA      1 - 70
GGAASDGSRGPGSPAGRGRPEATASATLVRSPGPRRSSAWAEGGSPRSTRSLLGDPRLRSPGSKGAESRL     71 - 140
RSPVRAKPIPGQKTSEADDAAGAAAAAARPAPREAQVSSVRIVSASGTVSEEIEVLEMVKEDEAPLALSD    141 - 210
AEQPPPATELESPAEECSWAGLFSFQDLRAVHQQLCSVNSQLEPCLPVFPEEPSGMWTVLFGGAPEMTEQ    211 - 280
EIDTLCYQLQVYLGHGLDTCGWKILSQVLFTETDDPEEYYESLSELRQKGYEEVLQRARKRIQELLDKHK    281 - 350
NTESMVELLDLYQMEDEAYSSLAEATTELYQYLLQPFRDMRELAMLRRQQIKISMENDYLGPRRIESLQK    351 - 420
EDADWQRKAHMAVLSIQDLTVKYFEITAKAQKAVYDRMRADQKKFGKASWAAAAERMEKLQYAVSKETLQ    421 - 490
MMRAKEICLEQRKHALKEEMQSLRGGTEAIARLDQLEADYYDLQLQLYEVQFEILKCEELLLTAQLESIK    491 - 560
RLISEKRDEVVYYDTYESMEAMLEKEEMAASAYLQREELQKLQQKARQLEARRGRVSAKKSYLRNKKEIC    561 - 630
IAKHNEKIQQRTRIEDEYRTHHTVQLKREKLHDEEERKSAWVSQERQRTLDRLRTFKQRYPGQVILKSTR    631 - 700
LRLAHARRKGAASPVLQEDHCDSLPSVLQVEEKTEEVGEGRVKRGPSQTTEPQSLVQLEDTSLTQLEATS    701 - 770
LPLSGVTSELPPTISLPLLNNNLEPCSVTINPLPSPLPPTPPPPPPPPPPPPPPPLPVAKDSGPETLEKD    771 - 840
LPRKEGNEKRIPKSASAPSAHLFDSSQLVSARKKLRKTAEGLQRRRVSSPMDEVLASLKRGSFHLKKVEQ    841 - 910
RTLPPFPDEDDSNNILAQIRKGVKLKKVQKDVLRESFTLLPDTDPLTRSIHEALRRIKEASPESEDEEEA    911 - 980
LPCTDWEN                                                                  981 - 988
//

Text Mined References (28)

PMID Year Title
26223951 2015 Actin nucleation by WH2 domains at the autophagosome.
26201719 2015 Identification of novel target genes specifically activated by deregulated E2F in human normal fibroblasts.
25416956 2014 A proteome-scale map of the human interactome network.
25343990 2015 Genome-wide association study of selenium concentrations.
25280461 2014 JMY protein, a regulator of P53 and cytoplasmic actin filaments, is expressed in normal and neoplastic tissues.
24069348 2013 JARID1A, JMY, and PTGER4 polymorphisms are related to ankylosing spondylitis in Chinese Han patients: a case-control study.
23758122 2013 JMY polymorphism is related to severity of ankylosing spondylitis in Chinese Han patients.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22316129 2012 Evolution of the eukaryotic ARP2/3 activators of the WASP family: WASP, WAVE, WASH, and WHAMM, and the proposed new family members WAWH and WAML.
22262458 2012 Actin binding to WH2 domains regulates nuclear import of the multifunctional actin regulator JMY.
More...