Property Summary

NCBI Gene PubMed Count 21
PubMed Score 21.20
PubTator Score 13.02

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.237 7.8e-05
adult high grade glioma -1.100 7.8e-03
glioblastoma -1.500 2.4e-03
group 3 medulloblastoma 1.200 1.8e-02
hepatocellular carcinoma -1.100 1.1e-04
juvenile dermatomyositis 1.417 1.5e-11
osteosarcoma -1.212 2.3e-04
ovarian cancer -1.100 4.9e-04
psoriasis 1.700 5.7e-28
spina bifida -2.531 4.8e-02

Gene RIF (10)

AA Sequence

MSFALEETLESDWVAVRPHVFDEREKHKFVFIVAWNEIEGKFAITCHNRTAQRQRSGSREQAGARGGAEA      1 - 70
GGAASDGSRGPGSPAGRGRPEATASATLVRSPGPRRSSAWAEGGSPRSTRSLLGDPRLRSPGSKGAESRL     71 - 140
RSPVRAKPIPGQKTSEADDAAGAAAAAARPAPREAQVSSVRIVSASGTVSEEIEVLEMVKEDEAPLALSD    141 - 210
AEQPPPATELESPAEECSWAGLFSFQDLRAVHQQLCSVNSQLEPCLPVFPEEPSGMWTVLFGGAPEMTEQ    211 - 280
EIDTLCYQLQVYLGHGLDTCGWKILSQVLFTETDDPEEYYESLSELRQKGYEEVLQRARKRIQELLDKHK    281 - 350
NTESMVELLDLYQMEDEAYSSLAEATTELYQYLLQPFRDMRELAMLRRQQIKISMENDYLGPRRIESLQK    351 - 420
EDADWQRKAHMAVLSIQDLTVKYFEITAKAQKAVYDRMRADQKKFGKASWAAAAERMEKLQYAVSKETLQ    421 - 490
MMRAKEICLEQRKHALKEEMQSLRGGTEAIARLDQLEADYYDLQLQLYEVQFEILKCEELLLTAQLESIK    491 - 560
RLISEKRDEVVYYDTYESMEAMLEKEEMAASAYLQREELQKLQQKARQLEARRGRVSAKKSYLRNKKEIC    561 - 630
IAKHNEKIQQRTRIEDEYRTHHTVQLKREKLHDEEERKSAWVSQERQRTLDRLRTFKQRYPGQVILKSTR    631 - 700
LRLAHARRKGAASPVLQEDHCDSLPSVLQVEEKTEEVGEGRVKRGPSQTTEPQSLVQLEDTSLTQLEATS    701 - 770
LPLSGVTSELPPTISLPLLNNNLEPCSVTINPLPSPLPPTPPPPPPPPPPPPPPPLPVAKDSGPETLEKD    771 - 840
LPRKEGNEKRIPKSASAPSAHLFDSSQLVSARKKLRKTAEGLQRRRVSSPMDEVLASLKRGSFHLKKVEQ    841 - 910
RTLPPFPDEDDSNNILAQIRKGVKLKKVQKDVLRESFTLLPDTDPLTRSIHEALRRIKEASPESEDEEEA    911 - 980
LPCTDWEN                                                                  981 - 988
//

Text Mined References (28)

PMID Year Title