Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.61
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8519 1.6e-09

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.900 1.6e-09

Gene RIF (2)

AA Sequence

MNSLEQAEDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCTATGAWNWLIDPETQKVSFFTSLWNHPFF      1 - 70
TISCITLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKPRPHVQ                    71 - 125
//

Text Mined References (9)

PMID Year Title