Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.02
PubTator Score 0.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
gastric cancer 1.500 0.010
osteosarcoma -1.117 0.008
ependymoma -1.200 0.000
group 4 medulloblastoma -1.800 0.000
astrocytoma -1.100 0.005
glioblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -2.000 0.000
primitive neuroectodermal tumor -1.100 0.001
pancreatic ductal adenocarcinoma liver m... -1.012 0.005
Parkinson's disease -1.100 0.009
adult high grade glioma -1.400 0.001
psoriasis 1.400 0.000
Pick disease -1.400 0.000
ovarian cancer -1.700 0.000
pituitary cancer -1.200 0.000

AA Sequence

MKRLGSVQRKMPCVFVTEVKEEPSSKREHQPFKVLATETVSHKALDADIYSAIPTEKVDGTCCYVTTYKD      1 - 70
QPYLWARLDRKPNKQAEKRFKNFLHSKENPKEFFWNVEEDFKPAPECWIPAKETEQINGNPVPDENGHIP     71 - 140
GWVPVEKNNKQYCWHSSVVNYEFEIALVLKHHPDDSGLLEISAVPLSDLLEQTLELIGTNINGNPYGLGS    141 - 210
KKHPLHLLIPHGAFQIRNLPSLKHNDLVSWFEDCKEGKIEGIVWHCSDGCLIKVHRHHLGLCWPIPDTYM    211 - 280
NSRPVIINMNLNKCDSAFDIKCLFNHFLKIDNQKFVRLKDIIFDV                             281 - 325
//

Text Mined References (10)

PMID Year Title
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
21269460 2011 Initial characterization of the human central proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.