Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.60
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung carcinoma 413 7.64782877763519E-24
glioblastoma multiforme 347 1.52088907509271E-21
lung carcinoma 2844 1.84881859872846E-19
lung adenocarcinoma 2714 6.82922221107894E-19
oligodendroglioma 2849 7.64793871343717E-18
pituitary cancer 1972 5.48273816270071E-10
medulloblastoma 1524 6.78009188239825E-8
pilocytic astrocytoma 3086 8.3211522587751E-7
atypical teratoid / rhabdoid tumor 4369 2.3772054293812E-4
primitive neuroectodermal tumor 3031 7.0081306163786E-4
Pick disease 1893 8.10079229686653E-4
medulloblastoma, large-cell 6234 0.00238670863504621
adult high grade glioma 2148 0.00529512400533608
ependymoma 2514 0.00640650315190991
astrocytic glioma 2241 0.0130067365957939
Alzheimer's disease 644 0.0470955380623734

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -2.800 0.013
ependymoma -3.600 0.006
glioblastoma multiforme -2.700 0.000
oligodendroglioma -2.900 0.000
medulloblastoma -3.400 0.000
atypical teratoid / rhabdoid tumor -2.700 0.000
medulloblastoma, large-cell -3.200 0.002
primitive neuroectodermal tumor -2.800 0.001
lung adenocarcinoma -3.200 0.000
adult high grade glioma -2.600 0.005
pilocytic astrocytoma -3.300 0.000
lung carcinoma -3.200 0.000
non-small cell lung carcinoma -2.200 0.000
Alzheimer's disease -1.700 0.047
Pick disease -2.300 0.001
pituitary cancer 3.700 0.000

Synonym

Accession Q8N987 Q6NUS7 Q96AZ7 Q9HBW8 EF-hand calcium-binding protein 1
Symbols EFCBP1
STIP-1

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

AA Sequence

MEDSQETSPSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEEFKAYFADGVLSGEELHELFH      1 - 70
TIDTHNTNNLDTEELCEYFSQHLGEYENVLAALEDLNLSILKAMGKTKKDYQEASNLEQFVTRFLLKETL     71 - 140
NQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSPQFNVSGPGLLEE    141 - 210
DNQWMTQINRLQKLIDRLEKKDLKLEPPEEEIIEGNTKSHIMLVQRQMSVIEEDLEEFQLALKHYVESAS    211 - 280
SQSGCLRISIQKLSNESRYMIYEFWENSSVWNSHLQTNYSKTFQRSNVDFLETPELTSTMLVPASWWILN    281 - 350
N//

Text Mined References (6)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17364817 2007 EFCBP1/NECAB1, a brain-specifically expressed gene with highest abundance in temporal lobe, encodes a protein containing EF-hand and antibiotic biosynthesis monooxygenase domains.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12044471 2002 NECABs: a family of neuronal Ca(2+)-binding proteins with an unusual domain structure and a restricted expression pattern.