Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.60
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -2.800 0.013
ependymoma -3.600 0.006
glioblastoma multiforme -2.700 0.000
oligodendroglioma -2.900 0.000
medulloblastoma -3.400 0.000
atypical teratoid / rhabdoid tumor -2.700 0.000
medulloblastoma, large-cell -3.200 0.002
primitive neuroectodermal tumor -2.800 0.001
lung adenocarcinoma -3.200 0.000
adult high grade glioma -2.600 0.005
pilocytic astrocytoma -3.300 0.000
lung carcinoma -3.200 0.000
non-small cell lung carcinoma -2.200 0.000
Alzheimer's disease -1.700 0.047
Pick disease -2.300 0.001
pituitary cancer 3.700 0.000

AA Sequence

MEDSQETSPSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEEFKAYFADGVLSGEELHELFH      1 - 70
TIDTHNTNNLDTEELCEYFSQHLGEYENVLAALEDLNLSILKAMGKTKKDYQEASNLEQFVTRFLLKETL     71 - 140
NQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSPQFNVSGPGLLEE    141 - 210
DNQWMTQINRLQKLIDRLEKKDLKLEPPEEEIIEGNTKSHIMLVQRQMSVIEEDLEEFQLALKHYVESAS    211 - 280
SQSGCLRISIQKLSNESRYMIYEFWENSSVWNSHLQTNYSKTFQRSNVDFLETPELTSTMLVPASWWILN    281 - 350
N//

Text Mined References (6)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17364817 2007 EFCBP1/NECAB1, a brain-specifically expressed gene with highest abundance in temporal lobe, encodes a protein containing EF-hand and antibiotic biosynthesis monooxygenase domains.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12044471 2002 NECABs: a family of neuronal Ca(2+)-binding proteins with an unusual domain structure and a restricted expression pattern.