Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.60
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -2.600 5.3e-03
Alzheimer's disease -1.700 4.7e-02
astrocytic glioma -2.800 1.3e-02
Astrocytoma, Pilocytic -3.300 6.7e-07
atypical teratoid / rhabdoid tumor -2.700 2.4e-04
ependymoma -3.600 6.4e-03
glioblastoma -2.600 2.7e-06
group 3 medulloblastoma -2.600 3.0e-02
lung adenocarcinoma -2.300 7.4e-08
lung carcinoma -3.200 1.8e-19
medulloblastoma, large-cell -3.200 2.4e-03
non-small cell lung carcinoma -2.200 7.6e-24
oligodendroglioma -2.900 7.6e-18
Pick disease -2.300 8.1e-04
pituitary cancer 3.700 5.5e-10
primitive neuroectodermal tumor -2.800 7.0e-04

Gene RIF (1)

AA Sequence

MEDSQETSPSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEEFKAYFADGVLSGEELHELFH      1 - 70
TIDTHNTNNLDTEELCEYFSQHLGEYENVLAALEDLNLSILKAMGKTKKDYQEASNLEQFVTRFLLKETL     71 - 140
NQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSPQFNVSGPGLLEE    141 - 210
DNQWMTQINRLQKLIDRLEKKDLKLEPPEEEIIEGNTKSHIMLVQRQMSVIEEDLEEFQLALKHYVESAS    211 - 280
SQSGCLRISIQKLSNESRYMIYEFWENSSVWNSHLQTNYSKTFQRSNVDFLETPELTSTMLVPASWWILN    281 - 350
N//

Text Mined References (7)

PMID Year Title