Property Summary

NCBI Gene PubMed Count 14
Grant Count 1
Funding $200,554.5
PubMed Score 1.39
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession Q8N983 B1AL06 B1AL07 B1AL09 B1AL10 C9J5Q3 D3DR71 Q5JW06 Q7Z719 Q7Z7H6 Q86XN1 Q9BYC7 L43mt
Symbols L43mt
MRP-L43
bMRP36a

Gene

 Grant Application (1)

PDB

3J9M   3J7Y  

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTARGTPSRFLASVLHNGLGRYVQQLQRLSFSVSRDGASSRGAREFVEREVIDFARRNPGVVIYVNSRPC      1 - 70
CVPRVVAEYLNGAVREESIHCKSVEEISTLVQKLADQSGLDVIRIRKPFHTDNPSIQGQWHPFTNKPTTF     71 - 140
RGLRPREVQDPAPAQDTGLRLSAVAPQILLPGWPDPPDLPTVDPISSSLTSAPAPMLSAVSCLPIVPALT    141 - 210
TVCSA                                                                     211 - 215
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15509589 2004 Twinkle helicase is essential for mtDNA maintenance and regulates mtDNA copy number.
More...