Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.64
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
cystic fibrosis 1.800 1.3e-05
group 3 medulloblastoma 1.300 1.4e-03
inflammatory breast cancer -1.500 3.8e-02
intraductal papillary-mucinous neoplasm ... -1.200 6.7e-03
non primary Sjogren syndrome sicca 1.200 2.4e-02
osteosarcoma -1.260 1.7e-04
ovarian cancer 1.100 1.7e-02
pediatric high grade glioma 1.100 9.8e-04

Gene RIF (2)

AA Sequence

MTARGTPSRFLASVLHNGLGRYVQQLQRLSFSVSRDGASSRGAREFVEREVIDFARRNPGVVIYVNSRPC      1 - 70
CVPRVVAEYLNGAVREESIHCKSVEEISTLVQKLADQSGLDVIRIRKPFHTDNPSIQGQWHPFTNKPTTF     71 - 140
RGLRPREVQDPAPAQDTGLRLSAVAPQILLPGWPDPPDLPTVDPISSSLTSAPAPMLSAVSCLPIVPALT    141 - 210
TVCSA                                                                     211 - 215
//

Text Mined References (18)

PMID Year Title