Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.39
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
cystic fibrosis 1670 1.26725092770679E-5
pediatric high grade glioma 2712 9.84409842185538E-4
group 3 medulloblastoma 2254 0.0013923897683239
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00666611397746018
osteosarcoma 7933 0.0164584405741306
ovarian cancer 8492 0.0169178640059454
non primary Sjogren syndrome sicca 840 0.0237714991888471
inflammatory breast cancer 404 0.0383860218661411
Disease Target Count Z-score Confidence
Mitochondrial DNA depletion syndrome 7 2 6.499 3.2

Expression

  Differential Expression (8)

Synonym

Accession Q8N983 B1AL06 B1AL07 B1AL09 B1AL10 C9J5Q3 D3DR71 Q5JW06 Q7Z719 Q7Z7H6 Q86XN1 Q9BYC7 L43mt
Symbols L43mt
MRP-L43
bMRP36a

Gene

PDB

3J9M   3J7Y  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTARGTPSRFLASVLHNGLGRYVQQLQRLSFSVSRDGASSRGAREFVEREVIDFARRNPGVVIYVNSRPC      1 - 70
CVPRVVAEYLNGAVREESIHCKSVEEISTLVQKLADQSGLDVIRIRKPFHTDNPSIQGQWHPFTNKPTTF     71 - 140
RGLRPREVQDPAPAQDTGLRLSAVAPQILLPGWPDPPDLPTVDPISSSLTSAPAPMLSAVSCLPIVPALT    141 - 210
TVCSA                                                                     211 - 215
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15509589 2004 Twinkle helicase is essential for mtDNA maintenance and regulates mtDNA copy number.
More...