Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.42
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.600 2.2e-04
Astrocytoma, Pilocytic -1.600 1.2e-06
atypical teratoid / rhabdoid tumor -1.700 3.0e-08
ependymoma -1.500 1.7e-11
glioblastoma -1.300 2.3e-07
group 4 medulloblastoma -1.200 3.0e-03
non primary Sjogren syndrome sicca 1.100 1.3e-02
primitive neuroectodermal tumor -1.500 2.9e-05

AA Sequence

MLAPGSSPGQRGRLALQWRQVSWITCWIALYAVEALPTCPFSCKCDSRSLEVDCSGLGLTTVPPDVPAAT      1 - 70
RTLLLLNNKLSALPSWAFANLSSLQRLDLSNNFLDRLPRSIFGDLTNLTELQLRNNSIRTLDRDLLRHSP     71 - 140
LLRHLDLSINGLAQLPPGLFDGLLALRSLSLRSNRLQNLDRLTFEPLANLQLLQVGDNPWECDCNLREFK    141 - 210
HWMEWFSYRGGRLDQLACTLPKELRGKDMRMVPMEMFNYCSQLEDENSSAGLDIPGPPCTKASPEPAKPK    211 - 280
PGAEPEPEPSTACPQKQRHRPASVRRAMGTVIIAGVVCGVVCIMMVVAAAYGCIYASLMAKYHRELKKRQ    281 - 350
PLMGDPEGEHEDQKQISSVA                                                      351 - 370
//

Text Mined References (5)

PMID Year Title