Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.900 1.0e-06
Breast cancer -1.100 8.7e-08
group 3 medulloblastoma 1.600 1.8e-02
posterior fossa group A ependymoma -1.300 1.2e-04
psoriasis -2.000 6.4e-08
subependymal giant cell astrocytoma -1.374 1.7e-02

AA Sequence

MLALRLLNVVAPAYFLCISLVTFVLQLFLFLPSMREDPAAARLFSPALLHGALFLFLSANALGNYVLVIQ      1 - 70
NSPDDLGACQGASARKTPCPSPSTHFCRVCARVTLRHDHHCFFTGNCIGSRNMRNFVLFCLYTSLACLYS     71 - 140
MVAGVAYISAVLSISFAHPLAFLTLLPTSISQFFSGAVLGSEMFVILMLYLWFAIGLACAGFCCHQLLLI    141 - 210
LRGQTRHQVRKGVAVRARPWRKNLQEVFGKRWLLGLLVPMFNVGSESSKQQDK                     211 - 263
//

Text Mined References (10)

PMID Year Title