Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.71
PubTator Score 2.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 1.200 3.9e-05
astrocytic glioma 2.400 1.9e-03
Atopic dermatitis -1.300 9.0e-04
chronic rhinosinusitis -1.296 3.3e-02
ependymoma 2.800 2.7e-03
glioblastoma 1.200 1.2e-03
interstitial cystitis -1.600 1.9e-03
intraductal papillary-mucinous carcinoma... 1.400 3.5e-02
intraductal papillary-mucinous neoplasm ... 2.700 2.2e-04
lung carcinoma -1.300 2.8e-04
oligodendroglioma 2.100 2.8e-03
ovarian cancer -1.700 1.3e-05
psoriasis -1.100 1.0e-28

Synonym

Accession Q8N957
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

Gene RIF (2)

AA Sequence

MEASLTRRLLFKDRHFTCSKIIGRRFACFAQRLSHRRKQSQCDLLNESTGQLPTTCSSAASNSINWNCRV      1 - 70
KMTQQMQNLHLCQSKKHSAPSSPNAAKRLYRNLSEKLKGSHSSFDEAYFRTRTDRLSLRKTSVNFQGNEA     71 - 140
MFEAVEQQDMDAVQILLYQYTPEELDLNTPNSEGLTPLDIAIMTNNVPIARILLRTGARESPHFVSLESR    141 - 210
AMHLNTLVQEAQERVSELSAQVENEGFTLDNTEKEKQLKAWEWRYRLYRRMKTGFEHARAPEMPTNVCLM    211 - 280
VTSSTSLTVSFQEPLSVNAAVVTRYKVEWSMSEDFSPLAGEIIMDNLQTLRCTITGLTMGQQYFVQVSAY    281 - 350
NMKGWGPAQTTTPACASPSNWKDYDDREPRHKGQSEVLEGLLQQVRALHQHYSCRESTKLQTTGRKQSVS    351 - 420
RSLKHLFHSSNKFVKTLKRGLYIAVIFYYKDNILVTNEDQVPIVEIDDSHTSSITQDFLWFTKLSCMWED    421 - 490
IRWLRQSIPISSSSSTVLQTRQKMLAATAQLQNLLGTHNLGRVYYEPIKDRHGNILIVTIREVEMLYSFF    491 - 560
NGKWMQISKLQSQRKSLSTPEEPTALDILLITIQDILSYHKRSHQRLFPGLYLGYLKLCSSVDQIKVLVT    561 - 630
QKLPNILCHVKIRENNNISREEWEWIQKLSGSESMESVDHTSDCPMQLFFYELQMAVKALLQQINIPLHQ    631 - 700
ARNFRLYTQEVLEMGHNVSFLLLLPASDDVCTAPGQNNPYTPHSGFLNLPLQMFELGIVACFT           701 - 763
//

Text Mined References (7)

PMID Year Title