Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.71
PubTator Score 2.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Cannabis dependence 18
Disease Target Count P-value
psoriasis 6685 1.19164712811992E-114
interstitial cystitis 2299 5.38345363102082E-6
ovarian cancer 8492 1.32483372454091E-5
pediatric high grade glioma 2712 3.92691837033707E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 2.23160613151921E-4
lung carcinoma 2844 2.82905218003068E-4
glioblastoma 5572 3.3045643483278E-4
Atopic dermatitis 944 9.04542169623593E-4
astrocytic glioma 2241 0.00192508096379765
ependymoma 2514 0.0026654960164881
oligodendroglioma 2849 0.00277377402878178
chronic rhinosinusitis 512 0.0333923964869874
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0348756906577399
Disease Target Count Z-score Confidence
substance-related disorder 105 0.0 1.0
Disease Target Count Z-score Confidence
Syndactyly 56 3.432 1.7

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma 2.400 0.002
ependymoma 2.800 0.003
oligodendroglioma 2.100 0.003
glioblastoma 1.400 0.000
Atopic dermatitis -1.300 0.001
intraductal papillary-mucinous carcinoma... 1.400 0.035
intraductal papillary-mucinous neoplasm ... 2.700 0.000
interstitial cystitis -2.100 0.000
pediatric high grade glioma 1.200 0.000
psoriasis -2.000 0.000
lung carcinoma -1.300 0.000
ovarian cancer -1.700 0.000
chronic rhinosinusitis -1.296 0.033

Synonym

Accession Q8N957
Symbols

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard EggNOG Inparanoid
C. elegans OMA EggNOG

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEASLTRRLLFKDRHFTCSKIIGRRFACFAQRLSHRRKQSQCDLLNESTGQLPTTCSSAASNSINWNCRV      1 - 70
KMTQQMQNLHLCQSKKHSAPSSPNAAKRLYRNLSEKLKGSHSSFDEAYFRTRTDRLSLRKTSVNFQGNEA     71 - 140
MFEAVEQQDMDAVQILLYQYTPEELDLNTPNSEGLTPLDIAIMTNNVPIARILLRTGARESPHFVSLESR    141 - 210
AMHLNTLVQEAQERVSELSAQVENEGFTLDNTEKEKQLKAWEWRYRLYRRMKTGFEHARAPEMPTNVCLM    211 - 280
VTSSTSLTVSFQEPLSVNAAVVTRYKVEWSMSEDFSPLAGEIIMDNLQTLRCTITGLTMGQQYFVQVSAY    281 - 350
NMKGWGPAQTTTPACASPSNWKDYDDREPRHKGQSEVLEGLLQQVRALHQHYSCRESTKLQTTGRKQSVS    351 - 420
RSLKHLFHSSNKFVKTLKRGLYIAVIFYYKDNILVTNEDQVPIVEIDDSHTSSITQDFLWFTKLSCMWED    421 - 490
IRWLRQSIPISSSSSTVLQTRQKMLAATAQLQNLLGTHNLGRVYYEPIKDRHGNILIVTIREVEMLYSFF    491 - 560
NGKWMQISKLQSQRKSLSTPEEPTALDILLITIQDILSYHKRSHQRLFPGLYLGYLKLCSSVDQIKVLVT    561 - 630
QKLPNILCHVKIRENNNISREEWEWIQKLSGSESMESVDHTSDCPMQLFFYELQMAVKALLQQINIPLHQ    631 - 700
ARNFRLYTQEVLEMGHNVSFLLLLPASDDVCTAPGQNNPYTPHSGFLNLPLQMFELGIVACFT           701 - 763
//

Text Mined References (6)

PMID Year Title
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
21668797 2011 A genome-wide association study of DSM-IV cannabis dependence.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18391950 2008 Identification of ten loci associated with height highlights new biological pathways in human growth.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.