Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.71
PubTator Score 2.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma 2.400 0.002
ependymoma 2.800 0.003
oligodendroglioma 2.100 0.003
glioblastoma 1.400 0.000
Atopic dermatitis -1.300 0.001
intraductal papillary-mucinous carcinoma... 1.400 0.035
intraductal papillary-mucinous neoplasm ... 2.700 0.000
interstitial cystitis -2.100 0.000
pediatric high grade glioma 1.200 0.000
psoriasis -2.000 0.000
lung carcinoma -1.300 0.000
ovarian cancer -1.700 0.000
chronic rhinosinusitis -1.296 0.033

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEASLTRRLLFKDRHFTCSKIIGRRFACFAQRLSHRRKQSQCDLLNESTGQLPTTCSSAASNSINWNCRV      1 - 70
KMTQQMQNLHLCQSKKHSAPSSPNAAKRLYRNLSEKLKGSHSSFDEAYFRTRTDRLSLRKTSVNFQGNEA     71 - 140
MFEAVEQQDMDAVQILLYQYTPEELDLNTPNSEGLTPLDIAIMTNNVPIARILLRTGARESPHFVSLESR    141 - 210
AMHLNTLVQEAQERVSELSAQVENEGFTLDNTEKEKQLKAWEWRYRLYRRMKTGFEHARAPEMPTNVCLM    211 - 280
VTSSTSLTVSFQEPLSVNAAVVTRYKVEWSMSEDFSPLAGEIIMDNLQTLRCTITGLTMGQQYFVQVSAY    281 - 350
NMKGWGPAQTTTPACASPSNWKDYDDREPRHKGQSEVLEGLLQQVRALHQHYSCRESTKLQTTGRKQSVS    351 - 420
RSLKHLFHSSNKFVKTLKRGLYIAVIFYYKDNILVTNEDQVPIVEIDDSHTSSITQDFLWFTKLSCMWED    421 - 490
IRWLRQSIPISSSSSTVLQTRQKMLAATAQLQNLLGTHNLGRVYYEPIKDRHGNILIVTIREVEMLYSFF    491 - 560
NGKWMQISKLQSQRKSLSTPEEPTALDILLITIQDILSYHKRSHQRLFPGLYLGYLKLCSSVDQIKVLVT    561 - 630
QKLPNILCHVKIRENNNISREEWEWIQKLSGSESMESVDHTSDCPMQLFFYELQMAVKALLQQINIPLHQ    631 - 700
ARNFRLYTQEVLEMGHNVSFLLLLPASDDVCTAPGQNNPYTPHSGFLNLPLQMFELGIVACFT           701 - 763
//

Text Mined References (6)

PMID Year Title
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
21668797 2011 A genome-wide association study of DSM-IV cannabis dependence.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18391950 2008 Identification of ten loci associated with height highlights new biological pathways in human growth.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.