Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 2.3302333502194E-5
primary Sjogren syndrome 789 4.99854758705646E-4
ductal carcinoma in situ 1745 7.54075452306246E-4
invasive ductal carcinoma 2950 0.00529351228552648

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 0.000
primary Sjogren syndrome 1.100 0.000
ductal carcinoma in situ -1.400 0.001
invasive ductal carcinoma -1.600 0.005

Synonym

Accession Q8N954 A8K0D9 B7Z2G4 B8ZZ44
Symbols CENPY
CCDC75
CENP-Y

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (1)

PMID Text
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAEEEDYMSDSFINVQEDIRPGLPMLRQIREARRKEEKQQEANLKNRQKSLKEEEQERRDIGLKNALGCE      1 - 70
NKGFALLQKMGYKSGQALGKSGGGIVEPIPLNIKTGKSGIGHEASLKRKAEEKLESYRKKIHMKNQAEEK     71 - 140
AAEQFRMRLKNKQDEMKLEGDLRRSQRACQQLDVQKNIQVPREAWYWLRLEEETEEDEEEKEQDEDEYKS    141 - 210
EDLSVLEKLQILTSYLREEHLYCIWCGTAYEDKEDLSSNCPGPTSADHD                         211 - 259
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20813266 2010 The protein composition of mitotic chromosomes determined using multiclassifier combinatorial proteomics.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15851553 2005 The lacrimal gland transcriptome is an unusually rich source of rare and poorly characterized gene transcripts.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...