Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.15

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 2.3e-05
ductal carcinoma in situ -1.400 7.5e-04
invasive ductal carcinoma -1.600 5.3e-03
primary Sjogren syndrome 1.100 5.0e-04

Gene RIF (1)

AA Sequence

MAEEEDYMSDSFINVQEDIRPGLPMLRQIREARRKEEKQQEANLKNRQKSLKEEEQERRDIGLKNALGCE      1 - 70
NKGFALLQKMGYKSGQALGKSGGGIVEPIPLNIKTGKSGIGHEASLKRKAEEKLESYRKKIHMKNQAEEK     71 - 140
AAEQFRMRLKNKQDEMKLEGDLRRSQRACQQLDVQKNIQVPREAWYWLRLEEETEEDEEEKEQDEDEYKS    141 - 210
EDLSVLEKLQILTSYLREEHLYCIWCGTAYEDKEDLSSNCPGPTSADHD                         211 - 259
//

Text Mined References (13)

PMID Year Title