Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.27
PubTator Score 2.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.600 9.0e-06
astrocytic glioma -1.200 3.0e-03
Astrocytoma, Pilocytic -1.600 6.1e-09
atypical teratoid / rhabdoid tumor -1.800 7.4e-10
ependymoma -1.200 2.2e-02
glioblastoma -1.500 9.2e-11
medulloblastoma, large-cell -1.100 1.2e-02
primitive neuroectodermal tumor -1.300 6.2e-04
subependymal giant cell astrocytoma -1.591 1.9e-02

Synonym

Accession Q8N944 B7ZLH6 Amer3
Symbols FAM123C

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MELKRGKTFIKSSLQVSHEKPPDPAAVAAAREGTGPWSVLPGGQQRPHSEKGPQASPSAQEYDRCPNKGA      1 - 70
QLDPKGGPAALCGATFKPVRKCKTHDSMSGAGRATAATGQLVGSASFPGSPGSRRMIDYRHFVPQMPFVP     71 - 140
AVAKSIPRKRISLKRPKKCFRNLFHIRRNKTEDLASLAAEGKSLPSPGDPSDPGGRRSKAFLPPGEGPGL    141 - 210
DGLCQDLLDSELLADASFGLCRALCEDVASLQSFDSLTGCGEVFADESSVPSLELNEGPESPTQAAQGLE    211 - 280
SKVPRGPLQGSVEQLASPAQNEASDFTRFWDSVNRSVRQQQRALLGPWLSGPQGTDRDQSRLDTAGLAEL    281 - 350
PLCPCRDPRSGSKASSIDTGTPKSEQPESVSTSDEGYYDSFSPGLEEDKKEAESPGTPAATFPRDSYSGD    351 - 420
ALYELFHDPSEGPLGPSPDDDLCVSESLSGPALGTPLSICSFRVGAEENLAPAPGPDLLSQGFLQSSWKG    421 - 490
KECLLKLCDTELAITMGIVSWLRRGPTPRAPPTPGQPAAPPGSQGAPRAPTEKLGGREGLASDAGGATVC    491 - 560
SAPSRQELWAHPGTTGLLAGESKALGGATQGTGTLSRDASREEETRGHSEGLFSSMESAATSTTDTSGKN    561 - 630
KAPVPSTWPCSQKEPGPPGVLGCFRGPWRPGHGGDTLDAEPMLAGCVARVAALKISSNEQPPAAWPPRQD    631 - 700
MGSGLFGQRWARGPDMLEQKQSSSSPSMTTIHGLPYSASTQDQRCRDRVQDLSWLRVEPTGLGVQAWASV    701 - 770
EDQPLQLSTEAVEQVAHGSQLDSEPRSAPAARWSSQGHHPESLGLTLNSQQEGGVSASAPECRCSLLARE    771 - 840
GLLCGQPEVGASGPAMAEPHL                                                     841 - 861
//

Text Mined References (7)

PMID Year Title