Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.27
PubTator Score 2.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ependymoma 2514 4.24398086272085E-20
atypical teratoid / rhabdoid tumor 4369 7.42582327669052E-10
pilocytic astrocytoma 3086 3.34488186497481E-9
glioblastoma 5572 1.00492634727194E-7
adult high grade glioma 2148 8.98326904769792E-6
primitive neuroectodermal tumor 3031 6.22955896418877E-4
astrocytic glioma 2241 0.00296049104788716
medulloblastoma, large-cell 6234 0.01204854586123
subependymal giant cell astrocytoma 2287 0.0194939908444157

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.200 0.003
ependymoma -1.700 0.000
glioblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -1.100 0.012
primitive neuroectodermal tumor -1.300 0.001
adult high grade glioma -1.600 0.000
pilocytic astrocytoma -1.600 0.000
subependymal giant cell astrocytoma -1.591 0.019

Synonym

Accession Q8N944 B7ZLH6 Amer3
Symbols FAM123C

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG

Gene RIF (1)

PMID Text
24251807 Data suggest Amer3 activates Wnt signaling, in contrast to Amer1/Amer2 which inhibit Wnt, suggesting non-redundant role of Amer proteins in regulation of Wnt pathway. Knockdown of Amer3 reduces Wnt target gene expression in colorectal cancer cells.

AA Sequence

MELKRGKTFIKSSLQVSHEKPPDPAAVAAAREGTGPWSVLPGGQQRPHSEKGPQASPSAQEYDRCPNKGA      1 - 70
QLDPKGGPAALCGATFKPVRKCKTHDSMSGAGRATAATGQLVGSASFPGSPGSRRMIDYRHFVPQMPFVP     71 - 140
AVAKSIPRKRISLKRPKKCFRNLFHIRRNKTEDLASLAAEGKSLPSPGDPSDPGGRRSKAFLPPGEGPGL    141 - 210
DGLCQDLLDSELLADASFGLCRALCEDVASLQSFDSLTGCGEVFADESSVPSLELNEGPESPTQAAQGLE    211 - 280
SKVPRGPLQGSVEQLASPAQNEASDFTRFWDSVNRSVRQQQRALLGPWLSGPQGTDRDQSRLDTAGLAEL    281 - 350
PLCPCRDPRSGSKASSIDTGTPKSEQPESVSTSDEGYYDSFSPGLEEDKKEAESPGTPAATFPRDSYSGD    351 - 420
ALYELFHDPSEGPLGPSPDDDLCVSESLSGPALGTPLSICSFRVGAEENLAPAPGPDLLSQGFLQSSWKG    421 - 490
KECLLKLCDTELAITMGIVSWLRRGPTPRAPPTPGQPAAPPGSQGAPRAPTEKLGGREGLASDAGGATVC    491 - 560
SAPSRQELWAHPGTTGLLAGESKALGGATQGTGTLSRDASREEETRGHSEGLFSSMESAATSTTDTSGKN    561 - 630
KAPVPSTWPCSQKEPGPPGVLGCFRGPWRPGHGGDTLDAEPMLAGCVARVAALKISSNEQPPAAWPPRQD    631 - 700
MGSGLFGQRWARGPDMLEQKQSSSSPSMTTIHGLPYSASTQDQRCRDRVQDLSWLRVEPTGLGVQAWASV    701 - 770
EDQPLQLSTEAVEQVAHGSQLDSEPRSAPAARWSSQGHHPESLGLTLNSQQEGGVSASAPECRCSLLARE    771 - 840
GLLCGQPEVGASGPAMAEPHL                                                     841 - 861
//

Text Mined References (7)

PMID Year Title
24251807 2014 Adenomatous polyposis coli (APC) membrane recruitment 3, a member of the APC membrane recruitment family of APC-binding proteins, is a positive regulator of Wnt-?-catenin signalling.
20843316 2010 The WTX/AMER1 gene family: evolution, signature and function.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.