Property Summary

NCBI Gene PubMed Count 3
Grant Count 3
Funding $45,193
PubMed Score 3.53
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 0.015
ductal carcinoma in situ -2.800 0.000
invasive ductal carcinoma -3.000 0.002
psoriasis -1.200 0.000

Gene RIF (1)

PMID Text
23029450 Nrac is a nutritionally-regulated adipose and cardiac-enriched gene.

AA Sequence

MRTAAGAVSPDSRPETRRQTRKNEEAAWGPRVCRAEREDNRKCPPSILKRSRPEHHRPEAKPQRTSRRVW      1 - 70
FREPPAVTVHYIADKNATATVRVPGRPRPHGGSLLLQLCVCVLLVLALGLYCGRAKPVATALEDLRARLL     71 - 140
GLVLHLRHVALTCWRGLLRL                                                      141 - 160
//

Text Mined References (4)

PMID Year Title
23029450 2012 Nrac, a novel nutritionally-regulated adipose and cardiac-enriched gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.