Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.53
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
ductal carcinoma in situ -2.300 3.8e-04
invasive ductal carcinoma -2.500 2.6e-03
non primary Sjogren syndrome sicca 1.200 1.5e-02
psoriasis -1.200 5.2e-05

Gene RIF (1)

AA Sequence

MRTAAGAVSPDSRPETRRQTRKNEEAAWGPRVCRAEREDNRKCPPSILKRSRPEHHRPEAKPQRTSRRVW      1 - 70
FREPPAVTVHYIADKNATATVRVPGRPRPHGGSLLLQLCVCVLLVLALGLYCGRAKPVATALEDLRARLL     71 - 140
GLVLHLRHVALTCWRGLLRL                                                      141 - 160
//

Text Mined References (4)

PMID Year Title