Property Summary

NCBI Gene PubMed Count 7
Grant Count 24
R01 Count 8
Funding $2,571,255.32
PubMed Score 786.32
PubTator Score 52.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.754 0.000
medulloblastoma, large-cell 1.100 0.011
group 3 medulloblastoma 1.700 0.001
ovarian cancer 1.200 0.000

Gene RIF (1)

PMID Text
22901808 A gain-of-function cDNA screen reveals that Coco, a secreted antagonist of TGF-beta ligands, induces dormant breast cancer cells to undergo reactivation in the lung.

AA Sequence

MLLGQLSTLLCLLSGALPTGSGRPEPQSPRPQSWAAANQTWALGPGALPPLVPASALGSWKAFLGLQKAR      1 - 70
QLGMGRLQRGQDEVAAVTLPLNPQEVIQGMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPT     71 - 140
PLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA                         141 - 189
//

Text Mined References (8)

PMID Year Title
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
22901808 2012 The BMP inhibitor Coco reactivates breast cancer cells at lung metastatic sites.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466485 2004 The activity of the Nodal antagonist Cerl-2 in the mouse node is required for correct L/R body axis.
15254711 2004 Identification and characterization of human CKTSF1B2 and CKTSF1B3 genes in silico.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14525956 2004 Comparative genomic analysis of the eight-membered ring cystine knot-containing bone morphogenetic protein antagonists.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.