Property Summary

NCBI Gene PubMed Count 9
PubMed Score 850.19
PubTator Score 52.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 4.4e-09
osteosarcoma 7950 1.9e-08
group 3 medulloblastoma 4104 1.2e-03
medulloblastoma, large-cell 6241 1.1e-02
Disease Target Count Z-score Confidence
Syringoma 11 4.127 2.1
Myopia 176 3.522 1.8
Astigmatism 54 3.323 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.700 1.2e-03
medulloblastoma, large-cell 1.100 1.1e-02
osteosarcoma -1.754 1.9e-08
ovarian cancer 1.200 4.4e-09

Synonym

Accession Q8N907
Symbols SP1
CER2
COCO
CRL2
CERL2
DANTE
GREM3
CKTSF1B3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MLLGQLSTLLCLLSGALPTGSGRPEPQSPRPQSWAAANQTWALGPGALPPLVPASALGSWKAFLGLQKAR      1 - 70
QLGMGRLQRGQDEVAAVTLPLNPQEVIQGMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPT     71 - 140
PLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA                         141 - 189
//

Text Mined References (10)

PMID Year Title