Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.56
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 8.2e-04
cystic fibrosis 1.033 1.0e-04
ependymoma -1.800 9.5e-03
gastric carcinoma 1.100 4.7e-02
interstitial cystitis 1.200 1.8e-04
intraductal papillary-mucinous adenoma (... 1.700 4.9e-03
invasive ductal carcinoma 1.326 3.6e-04
lung carcinoma -1.200 5.5e-13
osteosarcoma 2.196 3.6e-05
ovarian cancer 2.700 1.5e-04
pancreatic cancer 1.200 1.8e-04
Pick disease -1.100 2.8e-03
primary pancreatic ductal adenocarcinoma 1.904 8.6e-04

Gene RIF (4)

AA Sequence

MVPGARGGGALARAAGRGLLALLLAVSAPLRLQAEELGDGCGHLVTYQDSGTMTSKNYPGTYPNHTVCEK      1 - 70
TITVPKGKRLILRLGDLDIESQTCASDYLLFTSSSDQYGPYCGSMTVPKELLLNTSEVTVRFESGSHISG     71 - 140
RGFLLTYASSDHPDLITCLERASHYLKTEYSKFCPAGCRDVAGDISGNMVDGYRDTSLLCKAAIHAGIIA    141 - 210
DELGGQISVLQRKGISRYEGILANGVLSRDGSLSDKRFLFTSNGCSRSLSFEPDGQIRASSSWQSVNESG    211 - 280
DQVHWSPGQARLQDQGPSWASGDSSNNHKPREWLEIDLGEKKKITGIRTTGSTQSNFNFYVKSFVMNFKN    281 - 350
NNSKWKTYKGIVNNEEKVFQGNSNFRDPVQNNFIPPIVARYVRVVPQTWHQRIALKVELIGCQITQGNDS    351 - 420
LVWRKTSQSTSVSTKKEDETITRPIPSEETSTGINITTVAIPLVLLVVLVFAGMGIFAAFRKKKKKGSPY    421 - 490
GSAEAQKTDCWKQIKYPFARHQSAEFTISYDNEKEMTQKLDLITSDMADYQQPLMIGTGTVTRKGSTFRP    491 - 560
MDTDAEEAGVSTDAGGHYDCPQRAGRHEYALPLAPPEPEYATPIVERHVLRAHTFSAQSGYRVPGPQPGH    561 - 630
KHSLSSGGFSPVAGVGAQDGDYQRPHSAQPADRGYDRPKAVSALATESGHPDSQKPPTHPGTSDSYSAPR    631 - 700
DCLTPLNQTAMTALL                                                           701 - 715
//

Text Mined References (15)

PMID Year Title