Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.33
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Melanoma 261
Disease Target Count P-value
lung carcinoma 2844 5.46368735549121E-13
cystic fibrosis 1670 1.51657485578652E-5
osteosarcoma 7933 3.55206265096818E-5
ovarian cancer 8492 1.4895133269024E-4
interstitial cystitis 2299 1.82806772596642E-4
invasive ductal carcinoma 2950 3.64743643038755E-4
atypical teratoid / rhabdoid tumor 4369 8.21902394874421E-4
primary pancreatic ductal adenocarcinoma 1271 8.59380987736409E-4
Pick disease 1893 0.00280727865789788
pancreatic cancer 2300 0.00405886956479561
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00493633347696934
ependymoma 2514 0.00952287053675112
gastric carcinoma 832 0.0466234859615751
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0

Expression

  Differential Expression (13)

Disease log2 FC p
ependymoma -1.800 0.010
osteosarcoma 2.196 0.000
cystic fibrosis 1.166 0.000
atypical teratoid / rhabdoid tumor -1.400 0.001
primary pancreatic ductal adenocarcinoma 1.904 0.001
intraductal papillary-mucinous adenoma (... 1.700 0.005
pancreatic cancer 2.000 0.004
interstitial cystitis 1.200 0.000
invasive ductal carcinoma 1.326 0.000
lung carcinoma -1.200 0.000
Pick disease -1.100 0.003
gastric carcinoma 1.100 0.047
ovarian cancer 2.700 0.000

Synonym

Accession Q8N8Z6 Q5H992 Q8IYK5 Q8N7L9 Q96NH2
Symbols dJ94G16.1

Gene

  Ortholog (13)

Pathway (1)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18976975 Knockdown of discoidin, CUB and LCCL domain containing 1 (DCBLD1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MVPGARGGGALARAAGRGLLALLLAVSAPLRLQAEELGDGCGHLVTYQDSGTMTSKNYPGTYPNHTVCEK      1 - 70
TITVPKGKRLILRLGDLDIESQTCASDYLLFTSSSDQYGPYCGSMTVPKELLLNTSEVTVRFESGSHISG     71 - 140
RGFLLTYASSDHPDLITCLERASHYLKTEYSKFCPAGCRDVAGDISGNMVDGYRDTSLLCKAAIHAGIIA    141 - 210
DELGGQISVLQRKGISRYEGILANGVLSRDGSLSDKRFLFTSNGCSRSLSFEPDGQIRASSSWQSVNESG    211 - 280
DQVHWSPGQARLQDQGPSWASGDSSNNHKPREWLEIDLGEKKKITGIRTTGSTQSNFNFYVKSFVMNFKN    281 - 350
NNSKWKTYKGIVNNEEKVFQGNSNFRDPVQNNFIPPIVARYVRVVPQTWHQRIALKVELIGCQITQGNDS    351 - 420
LVWRKTSQSTSVSTKKEDETITRPIPSEETSTGINITTVAIPLVLLVVLVFAGMGIFAAFRKKKKKGSPY    421 - 490
GSAEAQKTDCWKQIKYPFARHQSAEFTISYDNEKEMTQKLDLITSDMADYQQPLMIGTGTVTRKGSTFRP    491 - 560
MDTDAEEAGVSTDAGGHYDCPQRAGRHEYALPLAPPEPEYATPIVERHVLRAHTFSAQSGYRVPGPQPGH    561 - 630
KHSLSSGGFSPVAGVGAQDGDYQRPHSAQPADRGYDRPKAVSALATESGHPDSQKPPTHPGTSDSYSAPR    631 - 700
DCLTPLNQTAMTALL                                                           701 - 715
//

Text Mined References (13)

PMID Year Title
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23478653 2014 A genome-wide association study of survival in small-cell lung cancer patients treated with irinotecan plus cisplatin chemotherapy.
23266556 2013 Identification of Genetic Susceptibility Loci for Colorectal Tumors in a Genome-Wide Meta-analysis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23143601 2012 Genome-wide association analysis identifies new lung cancer susceptibility loci in never-smoking women in Asia.
22566634 2012 The genetic architecture of economic and political preferences.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...